DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ modell-2014-1 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Modell JW., Kambara TK., Perchuk BS., Laub MT. DIP original experiment: DIP-262263X PLoS biology 2014 IMEx A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. Modell JW., Kambara TK., Perchuk BS., Laub MT. Only protein-protein interactions imex curation modell-2014-2 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Modell JW., Kambara TK., Perchuk BS., Laub MT. DIP original experiment: DIP-262266X PLoS biology 2014 IMEx A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. Modell JW., Kambara TK., Perchuk BS., Laub MT. Only protein-protein interactions imex curation modell-2014-3 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Modell JW., Kambara TK., Perchuk BS., Laub MT. DIP original experiment: DIP-262264X PLoS biology 2014 IMEx A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. Modell JW., Kambara TK., Perchuk BS., Laub MT. Only protein-protein interactions imex curation modell-2014-4 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Modell JW., Kambara TK., Perchuk BS., Laub MT. DIP original experiment: DIP-262267X PLoS biology 2014 IMEx A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. Modell JW., Kambara TK., Perchuk BS., Laub MT. Only protein-protein interactions imex curation modell-2014-5 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Modell JW., Kambara TK., Perchuk BS., Laub MT. DIP original experiment: DIP-262265X PLoS biology 2014 IMEx A DNA damage-induced, SOS-independent checkpoint regulates cell division in Caulobacter crescentus. Modell JW., Kambara TK., Perchuk BS., Laub MT. Only protein-protein interactions imex curation ftsn_cauvn Cell division protein FtsN ftsN CCNA_02086 protein protein strain na1000 / cb15 Caulobacter crescentus MSDPHRGAYTPPTDAPLSFDARQPVRGARPLPMTLIISAVVLVTLVVAVVMIYRDGVRGPNDAPQAVGTEVAQMKTPPAESSQPKDPASGLQIYHNEEPQPSATFAAPPETPLARPVAPTATTPVETASLPAAKPAAPAPTIESLATAAAAQKPAPKPVQVAQAAPKPVAAAPATTATAPKPAAVSTGPASVQIGALSSPALADKAWAEAVRLAPGLAAGKGKKVETVDKNGTTLYRTSVTGFATREAAKAFCEAIAASGKSCFVK a0a0h3cbr2_cauvn CCNA_03212 protein protein strain na1000 / cb15 Caulobacter crescentus MTDFAMTQPFAAPRRSARFVRPGRPGGLWGAVHYAGVLLVWLMLFVVDRPLALKVMAERRADSPIPRHWGW ftsw_cauvn Probable peptidoglycan glycosyltransferase FtsW ftsW Cell division protein FtsW Cell wall polymerase Peptidoglycan polymerase CCNA_02635 protein protein strain na1000 / cb15 Caulobacter crescentus MASNATHAFARTDRTALGLWWWTTDRWLLGATALLVTLGMLLSFASSPAAAQRIGIDDQFHFALRMCFFATASSVLMLITSMLSPRDIRRAAFFIYLGAIAVMIALPFIGHNAKGATRWLQFAGFTLQPSEFMKPALIVLVSWMFAEGQKGEGVPGVSIAFLLYFIAVALLLIQPDVGQTVLITIAFGAAFWMAGVPISWIMGLGGVALAGLGSTYFLFDHVHARVQKFLSPDQADTHQITRAAEAIRAGGLFGRGPGEGVMKRHVPDLHTDFIYSVAAEEYGLIFSWSLIGLFAFVVVRGLYKAMKLNDPFEQVAAAGLFVLVGQQALINIAVNLNMIPTKGMTLPFISYGGSSMLAMGLTLGMALALLRKRPGAYGASGEFGFGRADA sida_cauvn Cell division inhibitor SidA sidA SOS-induced inhibitor of cell division A CCNA_02004 protein protein strain na1000 / cb15 Caulobacter crescentus MIRVARESFALVSVIGFVWMMCTVANLVA dida-ftsn-1 3294784 N/A 3294789 unspecified role unspecified role prey prey B8GX61:p.Leu202Pro L202P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false B8GX61:p.Phe252Leu F252L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294790 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false ftsw-ftsn-1 3294785 N/A 3294791 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3294789 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false ftsn-dida-1 3294786 N/A 3294789 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3294790 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false ftsw-sida-1 3294787 N/A 3294791 unspecified role unspecified role bait bait B8H092:p.Ala31Lys A31K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294792 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false ftsn-sida-1 3294788 N/A 3294792 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3294789 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false