DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zouridakis-2014-1 picpa Pichia pastoris (Yeast) Yeast Pichia pastoris molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. DIP original experiment: DIP-262219X Nature structural & molecular biology 2014 IMEx Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. Only protein-protein interactions imex curation zouridakis-2014-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. DIP original experiment: DIP-262220X Nature structural & molecular biology 2014 IMEx Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. Only protein-protein interactions imex curation zouridakis-2014-3 in vitro In vitro pull down pull down autoradiography autoradiography Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. DIP original experiment: DIP-262221X Nature structural & molecular biology 2014 IMEx Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. Only protein-protein interactions imex curation acha9_human Neuronal acetylcholine receptor subunit alpha-9 CHRNA9 NACHRA9 Nicotinic acetylcholine receptor subunit alpha-9 protein protein human Homo sapiens Human MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD 3l21v_bunmu Alpha-bungarotoxin isoform V31 Long neurotoxin 1 protein protein bunmu Bungarus multicinctus Many-banded krait MKTLLLTLVVVTIVCLDLGYTIVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG chrna9-1 3270417 N/A 3270420 unspecified role unspecified role unspecified role unspecified role Region 26-237 Region 26-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false 3l21v_bunmu-chrna9-1 3270418 N/A 3270421 unspecified role unspecified role unspecified role unspecified role region 22-95 region 22-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false bunmu Bungarus multicinctus Many-banded krait N/A 3270420 unspecified role unspecified role unspecified role unspecified role Region 26-237 Region 26-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false chrna9-3l21v_bunmu-1 3270419 N/A 3270421 unspecified role unspecified role prey prey region 22-95 region 22-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 125I-label 125I-label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bunmu Bungarus multicinctus Many-banded krait N/A 3270420 unspecified role unspecified role bait bait Region 26-237 Region 26-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false