DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ giuntoli-2014-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Giuntoli B., Lee SC., Licausi F., Kosmacz M., Oosumi T., van Dongen JT., Bailey-Serres J., Perata P. DIP original experiment: DIP-262033X PLoS biology 2014 IMEx A trihelix DNA binding protein counterbalances hypoxia-responsive transcriptional activation in Arabidopsis. Giuntoli B., Lee SC., Licausi F., Kosmacz M., Oosumi T., van Dongen JT., Bailey-Serres J., Perata P. Only protein-protein interactions imex curation giuntoli-2014-2 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Giuntoli B., Lee SC., Licausi F., Kosmacz M., Oosumi T., van Dongen JT., Bailey-Serres J., Perata P. DIP original experiment: DIP-262031X PLoS biology 2014 IMEx A trihelix DNA binding protein counterbalances hypoxia-responsive transcriptional activation in Arabidopsis. Giuntoli B., Lee SC., Licausi F., Kosmacz M., Oosumi T., van Dongen JT., Bailey-Serres J., Perata P. Only protein-protein interactions imex curation giuntoli-2014-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Giuntoli B., Lee SC., Licausi F., Kosmacz M., Oosumi T., van Dongen JT., Bailey-Serres J., Perata P. DIP original experiment: DIP-262034X PLoS biology 2014 IMEx A trihelix DNA binding protein counterbalances hypoxia-responsive transcriptional activation in Arabidopsis. Giuntoli B., Lee SC., Licausi F., Kosmacz M., Oosumi T., van Dongen JT., Bailey-Serres J., Perata P. Only protein-protein interactions imex curation giuntoli-2014-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Giuntoli B., Lee SC., Licausi F., Kosmacz M., Oosumi T., van Dongen JT., Bailey-Serres J., Perata P. DIP original experiment: DIP-262032X PLoS biology 2014 IMEx A trihelix DNA binding protein counterbalances hypoxia-responsive transcriptional activation in Arabidopsis. Giuntoli B., Lee SC., Licausi F., Kosmacz M., Oosumi T., van Dongen JT., Bailey-Serres J., Perata P. Only protein-protein interactions imex curation q8rwy5_arath At3g10040 HRA1 HYPOXIA RESPONSE ATTENUATOR1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESNVMFSGFSPRMLSLEMPQNPPNPQNSIQFQHPHPYTTSGDQQTQPPIKSLYPYASKPKQMSPISGGGCDDEDRGSGSGSGCNPEDSAGTDGKRKLSQWHRMKWTDTMVRLLIMAVFYIGDEAGLNDPVDAKKKTGGGGGGGGGGGMLQKKGKWKSVSRAMVEKGFSVSPQQCEDKFNDLNKRYKRVNDILGKGIACRVVENQGLLESMDHLTPKLKDEVKKLLNSKHLFFREMCAYHNSCGHLGGHDQQPPQQNPISIPIPSQQQNCFHAAEAGKMARIAERVEVEEEVESDMAEDSESEMEESEEEETRKKRRISTAVKRLREEAASVVEDVGKSVWEKKEWIRRKMLEIEEKKIGYEWEGVEMEKQRVKWMRYRSKKEREMEKAKLDNQRRRLETERMILMLRRSEIELNELQSSGTRVDPSSAKG ra212_arath Ethylene-responsive transcription factor RAP2-12 RAP2-12 ERF074 Protein RELATED TO APETALA2 12 T18A20.14 At1g53910 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCGGAIISDFIPPPRSRRVTSEFIWPDLKKNLKGSKKSSKNRSNFFDFDAEFEADFQGFKDDSSIDCDDDFDVGDVFADVKPFVFTSTPKPAVSAAAEGSVFGKKVTGLDGDAEKSANRKRKNQYRGIRQRPWGKWAAEIRDPREGARIWLGTFKTAEEAARAYDAAARRIRGSKAKVNFPEENMKANSQKRSVKANLQKPVAKPNPNPSPALVQNSNISFENMCFMEEKHQVSNNNNNQFGMTNSVDAGCNGYQYFSSDQGSNSFDCSEFGWSDQAPITPDISSAVINNNNSALFFEEANPAKKLKSMDFETPYNNTEWDASLDFLNEDAVTTQDNGANPMDLWSIDEIHSMIGGVF rap2_12-hra1-1 3270161 N/A 3270165 unspecified role unspecified role prey prey Region 194-431 Region 194-431 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3270166 unspecified role unspecified role bait bait Region 1-177 Region 1-177 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false hra1-rap2_12-1 3270162 N/A 3270165 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3270166 unspecified role unspecified role unspecified role unspecified role Region 14-358 Region 14-358 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false rap2_12-hra1-2 3270163 N/A 3270165 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3270166 unspecified role unspecified role bait bait Region 1-123 Region 1-123 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false hra1-rap2_12-2 3270164 N/A 3270165 unspecified role unspecified role bait bait Region 194-431 Region 194-431 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3270166 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false