DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ xu-2014-4 in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-262329X Nature 2014 IMEx Structures of bacterial homologues of SWEET transporters in two distinct conformations. Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation xu-2014-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-262325X Nature 2014 IMEx Structures of bacterial homologues of SWEET transporters in two distinct conformations. Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation xu-2014-6 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-262326X Nature 2014 IMEx Structures of bacterial homologues of SWEET transporters in two distinct conformations. Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation xu-2014-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-262327X Nature 2014 IMEx Structures of bacterial homologues of SWEET transporters in two distinct conformations. Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation xu-2014-8 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-262328X Nature 2014 IMEx Structures of bacterial homologues of SWEET transporters in two distinct conformations. Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation sweet_bradu Sugar transporter SemiSWEET bsr6460 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MDPFLIKLIGFAAATCTTVAYAPQFIKVLKTRSARDISLGMFLVMVLGLALWLIYGLLSGDAPLIASNAVTMLLAGGILVMKLRYG sweet_lepbp Sugar transporter SemiSWEET LEPBI_I1613 protein protein lepbp Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILANVVTLFFVTIILYYKLTEGNQT sweet_vibsn Sugar transporter SemiSWEET VIBRN418_06191 protein protein vibsn Vibrio sp. (strain N418) MALIERIGKALEPLMLVMGLISPLATMPQLYKLYVSHSEHALGLSLTTWLLYSFIALLWTIYGIYHKNPTIWVGNCLGFLMYVAMVVGIIAHTGGTY sweet_bradu-1 3269613 N/A 3269618 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sweet_lepbp-1 3269614 N/A 3269619 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sweet_vibsn-1 3269615 N/A 3269620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sweet_vibsn-2 3269616 N/A 3269620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sweet_vibsn-3 3269617 N/A 3269620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false