DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hsia-2014-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262394X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-2 trini Trichoplusia ni (Cabbage looper) Cabbage looper tem transmission electron microscopy tem predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262403X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262398X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-4 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262406X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-5 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262395X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-6 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262405X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262401X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-8 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262408X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-9 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262396X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-10 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262407X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-11 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262399X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-12 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262402X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-13 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262400X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-14 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262397X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation hsia-2014-15 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. DIP original experiment: DIP-262404X Nature cell biology 2014 IMEx Reconstitution of the augmin complex provides insights into its architecture and function. Hsia KC., Wilson-Kubalek EM., Dottore A., Hao Q., Tsai KL., Forth S., Shimamoto Y., Milligan RA., Kapoor TM. Only protein-protein interactions imex curation haus6_human HAUS augmin-like complex subunit 6 HAUS6 DGT6 FAM29A KIAA1574 protein protein human Homo sapiens Human MSSASVTAFEKEHLWMYLQALGFEPGPATIACGKIVSHTHLGVNMFDKLNRDAFHIISYFLFQVLDQSLTKEVFKFCWPPFDQKSDTEFRKHCCEWIKRISGECGSSFPQVVGSLFLSPGGPKFIHLMYHFARFVAMKYIKSNSKNSSHHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKMEPYDDHSNMEEKIQKVRSLWASVNETLMFLEKEREVVSSVLSLVNQYALDGTNVAINIPRLLLDKIEKQMFQLHIGNVYEAGKLNLLTVIQLLNEVLKVMKYERCQADQARLTVDLHYLEKETKFQKERLSDLKHMRYRIKDDLTTIRHSVVEKQGEWHKKWKEFLGLSPFSLIKGWTPSVDLLPPMSPLSFDPASEEVYAKSILCQYPASLPDAHKQHNQENGCRGDSDTLGALHDLANSPASFLSQSVSSSDRNSVTVLEKDTKMGTPKEKNEAISKKIPEFEVENSPLSDVAKNTESSAFGGSLPAKKSDPFQKEQDHLVEEVARAVLSDSPQLSEGKEIKLEELIDSLGSNPFLTRNQIPRTPENLITEIRSSWRKAIEMEENRTKEPIQMDAEHREVLPESLPVLHNQREFSMADFLLETTVSDFGQSHLTEEKVISDCECVPQKHVLTSHIDEPPTQNQSDLLNKKVICKQDLECLAFTKLSETSRMETFSPAVGNRIDVMGGSEEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGISSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQALRSRYEALKKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTDDTLNFLDTCDLHTEHIKPSLRTSIGERKRSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLTR haus8_human HAUS augmin-like complex subunit 8 HICE1 HEC1/NDC80-interacting centrosome-associated protein 1 Sarcoma antigen NY-SAR-48 HAUS8 protein protein human Homo sapiens Human MADSSGRGAGKPATGPTNSSSAKKKDKRVQGGRVIESRYLQYEKKTTQKAPAGDGSQTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSAINDKSIVKKTPQLAKTISKKPESTSFSAPRKKSPDLSEAMEMMESQTLLLTLLSVKMENNLAEFERRAEKNLLIMCKEKEKLQKKAHELKRRLLLSQRKRELADVLDAQIEMLSPFEAVATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQDSACRESGGAPKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPPSLSRSGRDLS haus5_human HAUS augmin-like complex subunit 5 HAUS5 KIAA0841 protein protein human Homo sapiens Human MELAQEARELGCWAVEEMGVPVAARAPESTLRRLCLGQGADIWAYILQHVHSQRTVKKIRGNLLWYGHQDSPQVRRKLELEAAVTRLRAEIQELDQSLELMERDTEAQDTAMEQARQHTQDTQRRALLLRAQAGAMRRQQHTLRDPMQRLQNQLRRLQDMERKAKVDVTFGSLTSAALGLEPVVLRDVRTACTLRAQFLQNLLLPQAKRGSLPTPHDDHFGTSYQQWLSSVETLLTNHPPGHVLAALEHLAAEREAEIRSLCSGDGLGDTEISRPQAPDQSDSSQTLPSMVHLIQEGWRTVGVLVSQRSTLLKERQVLTQRLQGLVEEVERRVLGSSERQVLILGLRRCCLWTELKALHDQSQELQDAAGHRQLLLRELQAKQQRILHWRQLVEETQEQVRLLIKGNSASKTRLCRSPGEVLALVQRKVVPTFEAVAPQSRELLRCLEEEVRHLPHILLGTLLRHRPGELKPLPTVLPSIHQLHPASPRGSSFIALSHKLGLPPGKASELLLPAAASLRQDLLLLQDQRSLWCWDLLHMKTSLPPGLPTQELLQIQASQEKQQKENLGQALKRLEKLLKQALERIPELQGIVGDWWEQPGQAALSEELCQGLSLPQWRLRWVQAQGALQKLCS haus3_human HAUS augmin-like complex subunit 3 HAUS3 C4orf15 protein protein human Homo sapiens Human MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLKIQRRNKCQLMASVTSHKSLRLNAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQGTNPLVFLSQFSLEKYLSQEEQSTAALTLYTKKQFFQGIHEVVESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLKASNSSMKSSIKWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVVRENAQLLNMPVVKGDFDLQIAKQDYYTARQELVLNQLIKQKASFELLQLSYEIELRKHRDIYRQLENLVQELSQSNMMLYKQLEMLTDPSVSQQINPRNTIDTKDYSTHRLYQVLEGENKKKELFLTHGNLEEVAEKLKQNISLVQDQLAVSAQEHSFFLSKRNKDVDMLCDTLYQGGNQLLLSDQELTEQFHKVESQLNKLNHLLTDILADVKTKRKTLANNKLHQMEREFYVYFLKDEDYLKDIVENLETQSKIKAVSLED haus1_human HAUS augmin-like complex subunit 1 HAUS1 CCDC5 HEIC Coiled-coil domain-containing protein 5 Enhancer of invasion-cluster protein protein human Homo sapiens Human MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVNDLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL haus4_human HAUS augmin-like complex subunit 4 HAUS4 C14orf94 protein protein human Homo sapiens Human MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKEVRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLLGLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQQQCQDAKSQQKEQMLLLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLRMEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATENKRWALQEFSKVYR haus7_human HAUS augmin-like complex subunit 7 HAUS7 26S proteasome-associated UCH37-interacting protein 1 X-linked protein STS1769 UIP1 UCHL5IP UCHL5-interacting protein protein protein human Homo sapiens Human MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLATKMNELMEK haus2_human HAUS augmin-like complex subunit 2 HAUS2 C15orf25 CEP27 Centrosomal protein of 27 kDa protein protein human Homo sapiens Human MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK haus6-haus8-2 3269480 N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false haus1-haus2-2 3269481 N/A 3269497 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269498 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269499 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269500 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269501 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269502 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269496 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false haus1-haus4-3 3269482 N/A 3269499 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269500 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false haus2-haus6-3 3269483 N/A 3269501 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269502 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false haus6-haus8-3 3269484 N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false haus1-haus4-4 3269485 N/A 3269499 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269500 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false haus1-haus4-5 3269486 N/A 3269499 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269500 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false haus6-haus8-4 3269487 N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false haus2-haus6-4 3269488 N/A 3269501 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269502 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false haus1-haus4-6 3269489 N/A 3269499 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269500 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false haus1-haus4-7 3269490 N/A 3269499 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269500 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false haus1-haus2-3 3269491 N/A 3269497 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269498 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269499 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269500 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269501 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269502 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3269496 unspecified role unspecified role unspecified role unspecified role Region 141-410 Region 141-410 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false haus1-haus2-4 3269492 N/A 3269499 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269500 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269501 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269502 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false haus2-haus6-5 3269493 N/A 3269501 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269502 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false haus2-haus6-6 3269494 N/A 3269501 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269502 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269495 unspecified role unspecified role unspecified role unspecified role Region 1-432 Region 1-432 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false