DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ huo-2014-4 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Huo Y., Nam KH., Ding F., Lee H., Wu L., Xiao Y., Farchione MD., Zhou S., Rajashankar K., Kurinov I., Zhang R., Ke A. DIP original experiment: DIP-262116X Nature structural & molecular biology 2014 IMEx Structures of CRISPR Cas3 offer mechanistic insights into Cascade-activated DNA unwinding and degradation. Huo Y., Nam KH., Ding F., Lee H., Wu L., Xiao Y., Farchione MD., Zhou S., Rajashankar K., Kurinov I., Zhang R., Ke A. Only protein-protein interactions imex curation huo-2014-5 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Huo Y., Nam KH., Ding F., Lee H., Wu L., Xiao Y., Farchione MD., Zhou S., Rajashankar K., Kurinov I., Zhang R., Ke A. DIP original experiment: DIP-262119X Nature structural & molecular biology 2014 IMEx Structures of CRISPR Cas3 offer mechanistic insights into Cascade-activated DNA unwinding and degradation. Huo Y., Nam KH., Ding F., Lee H., Wu L., Xiao Y., Farchione MD., Zhou S., Rajashankar K., Kurinov I., Zhang R., Ke A. Only protein-protein interactions imex curation huo-2014-6 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Huo Y., Nam KH., Ding F., Lee H., Wu L., Xiao Y., Farchione MD., Zhou S., Rajashankar K., Kurinov I., Zhang R., Ke A. DIP original experiment: DIP-262118X Nature structural & molecular biology 2014 IMEx Structures of CRISPR Cas3 offer mechanistic insights into Cascade-activated DNA unwinding and degradation. Huo Y., Nam KH., Ding F., Lee H., Wu L., Xiao Y., Farchione MD., Zhou S., Rajashankar K., Kurinov I., Zhang R., Ke A. Only protein-protein interactions imex curation huo-2014-7 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Huo Y., Nam KH., Ding F., Lee H., Wu L., Xiao Y., Farchione MD., Zhou S., Rajashankar K., Kurinov I., Zhang R., Ke A. DIP original experiment: DIP-262120X Nature structural & molecular biology 2014 IMEx Structures of CRISPR Cas3 offer mechanistic insights into Cascade-activated DNA unwinding and degradation. Huo Y., Nam KH., Ding F., Lee H., Wu L., Xiao Y., Farchione MD., Zhou S., Rajashankar K., Kurinov I., Zhang R., Ke A. Only protein-protein interactions imex curation huo-2014-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Huo Y., Nam KH., Ding F., Lee H., Wu L., Xiao Y., Farchione MD., Zhou S., Rajashankar K., Kurinov I., Zhang R., Ke A. DIP original experiment: DIP-262117X Nature structural & molecular biology 2014 IMEx Structures of CRISPR Cas3 offer mechanistic insights into Cascade-activated DNA unwinding and degradation. Huo Y., Nam KH., Ding F., Lee H., Wu L., Xiao Y., Farchione MD., Zhou S., Rajashankar K., Kurinov I., Zhang R., Ke A. Only protein-protein interactions imex curation q47pj2_thefy Tfu_1591 protein protein thefy Thermobifida fusca (strain YX) MNSDYILQHADALVKRVSKLIVNEPAARAALRRGVGLAPEDPRMLAAHRVVAPYVPVPTDYDVDRRRAASLWDVHAVERAFYAVAAIMAAQPRSARDQEAEATEEQTGEPQDSEALTEPTPAEESSATKDGKPDRRPNLGVSLAQAVFDKGLNADSTEQRLHLIARQNLDGVHRHLPRLVLYLRSDQVHIDWGILIRDLARWGHTPRHVAREWVQDYHRTLETLTRQAEQKNKNNTTDEEAEAA mint q47pj5_thefy Tfu_1588 protein protein thefy Thermobifida fusca (strain YX) MTWLTKIVPDLRYRQTRADFRTAGNLHRKLIRLSSDLGEERIANPRQQSGLLFRIEETRNELYLLVQSHSPLRVDRLGPGYHGVQMRNLDPFLARLDKGSRVRYRIVASPTKRLGRSENNTQRLGLKEPPKKPREYTWALRGAAAEEWWHSRAAANGLELLSTYAQTLDDVRDPGTADRSRKIRHPAVRFDGEAVISDVDAVRHAVLNGIGRGKSYGCGLLSLALIEEGEHG q47pj4_thefy Tfu_1589 protein protein thefy Thermobifida fusca (strain YX) MSGFLLRLAGPMQSWGEHSMFGERDTLPYPSRSGLIGMFAAAQGVRRGDPLDRYKELKFTVRVDRPGVRLVDFHTIGGGLPKERTVPTAAGERRDPKKATIVTSRSYLADAVFTVAVTGPEADTIADALAAPYWQPYLGRRAFVPDPLLVLRRRVADPVRELVEAVPLPHRRVEEDAATVLVDLIYEEGEYPDTRTLTVLNDVPLSFDSKSRRYSTRQIRVVPTEVPATLVAGPGRDYQNKLFTYVKQCAEEAA q47pj3_thefy Tfu_1590 protein protein thefy Thermobifida fusca (strain YX) MTFVDIHAIQTLPYSNINRDDLGSPKTVVYGGKERTRVSSQSWKRAVRHEVEARLGDKAVRTRRIISEIAKRLRERGWDADLADAGARQVVLSVGKKSGIKLEKEKDSEAPATSVLFYLPVPAIDELAAIADEHRDAVAKEAAKKTPKGILPADRITEVLKSRNVSVNLFGRMLAELPSTEVDGAVQFAHAFTVHGTTVEVDFFTAVDDIPKENDHGSGHMNAGQFSAGTFYRYANVNLDRLVENTGDAQTARTAVAEFLRAFLSTVPSGKQNATAAMTLPDLVHIAVRFDRPISFAPAFETALYGSDGYTLRACQELNNYAERLREVWPDDAIRGYATVENKTDLAALGERYDSYPALIDAMVAAAFEGERE q47pj1_thefy Tfu_1592 protein protein thefy Thermobifida fusca (strain YX) MLSVALCFLVGGAIPSPPSFDVTIAPWLIARSRDVLAAPEMLGLRDVLIRSHELSDVEIPLPPGAAVLWRILALITARITGLDQPPNKNPKRKWQARRSQILSKGRLDPEAVDAYFADYSERFDLFHPERPWLQDPRLREECPKTSGVNKLAWGRTAGENQVWLGGHHHDLDPHPLDSAEAVWHLLATLGYGPSGMCTARVVRGRSERNVTAGPLRGTVSYHPLGRTLFESLILNIPYPGTGAADLAFWEQPELNDPLGLPEESAGLAGILRLDHFRHAVLLHPSPDGSHVVDAWVTWAWRERNISPELDPYLIYQTSKEGRVYPRPAEAERAIWRDLDALLHYGEDGNYRPTILDNCTPLAQVPQEVLDSLRLRAFGFDQDGQARDKQWFTATTPAVLRWLADRETDDNENARIVRRITLARKAAEALGRRLEKACKEAWKESNSPSSTSSGTNAKTETGVGPWVQHGMSRYWAKAEPVFWNIVYDRPAQGYTPGMAGPGNAFNLVALAAYDEVTGPYCERPRVAKVVERHRSTLFSNWTPKQDKEAA q47pj2_thefy-q47pj1_thefy-1 3269069 N/A 3269074 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3269075 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3269076 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3269077 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3269078 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false q47pj2_thefy-q47pj3_thefy-1 3269070 N/A 3269074 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3269075 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3269076 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3269077 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false q47pj2_thefy-q47pj3_thefy-2 3269071 N/A 3269074 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269075 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269076 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269077 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false q47pj2_thefy-q47pj3_thefy-3 3269072 N/A 3269074 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269075 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269076 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269077 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli association association false false false q47pj1_thefy-q47pj2_thefy-1 3269073 N/A 3269074 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269075 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269076 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269077 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3269078 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false