DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ liu-2014-40 drome Drosophila melanogaster (Fruit fly) Fruit fly molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. DIP original experiment: DIP-261977X Structure (London, England : 1993) 2014 IMEx Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly. Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. Only protein-protein interactions imex curation liu-2014-41 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. DIP original experiment: DIP-261980X Structure (London, England : 1993) 2014 IMEx Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly. Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. Only protein-protein interactions imex curation liu-2014-42 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. DIP original experiment: DIP-261982X Structure (London, England : 1993) 2014 IMEx Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly. Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. Only protein-protein interactions imex curation liu-2014-43 drome Drosophila melanogaster (Fruit fly) Fruit fly sls static light scattering sls predetermined predetermined participant predetermined Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. DIP original experiment: DIP-261978X Structure (London, England : 1993) 2014 IMEx Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly. Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. Only protein-protein interactions imex curation liu-2014-44 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. DIP original experiment: DIP-261981X Structure (London, England : 1993) 2014 IMEx Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly. Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. Only protein-protein interactions imex curation liu-2014-45 drome Drosophila melanogaster (Fruit fly) Fruit fly x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. DIP original experiment: DIP-261979X Structure (London, England : 1993) 2014 IMEx Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly. Liu W., Zhan C., Cheng H., Kumar PR., Bonanno JB., Nathenson SG., Almo SC. Only protein-protein interactions imex curation o43557-1 Tumor necrosis factor ligand superfamily member 14 TNFSF14 HVEML LIGHT UNQ391/PRO726 Herpes virus entry mediator ligand protein protein human Homo sapiens Human MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV tnf6b_human Tumor necrosis factor receptor superfamily member 6B Decoy receptor for Fas ligand Decoy receptor 3 M68 UNQ186/PRO212 TNFRSF6B DCR3 TR6 protein protein human Homo sapiens Human MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQRPCRRDSPTTCGPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFFAHAGFCLEHASCPPGAGVIAPGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLALNVPGSSSHDTLCTSCTGFPLSTRVPGAEECERAVIDFVAFQDISIKRLQRLLQALEAPEGWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQALRVARMPGLERSVRERFLPVH tnfsf14-1 3268549 N/A 3268555 unspecified role unspecified role unspecified role unspecified role Region 83-240 Region 83-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false tnfrsf6b-tnfsf14-1 3268550 N/A 3268556 unspecified role unspecified role unspecified role unspecified role Region 30-195 Region 30-195 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3268555 unspecified role unspecified role unspecified role unspecified role Region 83-240 Region 83-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false tnfrsf6b-tnfsf14-2 3268551 N/A 3268556 unspecified role unspecified role unspecified role unspecified role Region 30-195 Region 30-195 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3268555 unspecified role unspecified role unspecified role unspecified role Region 83-240 Region 83-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false tnfsf14-2 3268552 N/A 3268555 unspecified role unspecified role unspecified role unspecified role Region 83-240 Region 83-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false tnfrsf6b-tnfsf14-3 3268553 N/A 3268556 unspecified role unspecified role unspecified role unspecified role Region 30-195 Region 30-195 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3268555 unspecified role unspecified role unspecified role unspecified role Region 83-240 Region 83-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false tnfsf14-3 3268554 N/A 3268555 unspecified role unspecified role unspecified role unspecified role Region 83-240 Region 83-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false