DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sevenich-2014-1 in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot Sevenich L., Bowman RL., Mason SD., Quail DF., Rapaport F., Elie BT., Brogi E., Brastianos PK., Hahn WC., Holsinger LJ., Massagué J., Leslie CS., Joyce JA. DIP original experiment: DIP-262380X Nature cell biology 2014 IMEx Analysis of tumour- and stroma-supplied proteolytic networks reveals a brain-metastasis-promoting role for cathepsin S. Sevenich L., Bowman RL., Mason SD., Quail DF., Rapaport F., Elie BT., Brogi E., Brastianos PK., Hahn WC., Holsinger LJ., Massagué J., Leslie CS., Joyce JA. Only protein-protein interactions imex curation sevenich-2014-2 in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot Sevenich L., Bowman RL., Mason SD., Quail DF., Rapaport F., Elie BT., Brogi E., Brastianos PK., Hahn WC., Holsinger LJ., Massagué J., Leslie CS., Joyce JA. DIP original experiment: DIP-262378X Nature cell biology 2014 IMEx Analysis of tumour- and stroma-supplied proteolytic networks reveals a brain-metastasis-promoting role for cathepsin S. Sevenich L., Bowman RL., Mason SD., Quail DF., Rapaport F., Elie BT., Brogi E., Brastianos PK., Hahn WC., Holsinger LJ., Massagué J., Leslie CS., Joyce JA. Only protein-protein interactions imex curation sevenich-2014-3 in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot Sevenich L., Bowman RL., Mason SD., Quail DF., Rapaport F., Elie BT., Brogi E., Brastianos PK., Hahn WC., Holsinger LJ., Massagué J., Leslie CS., Joyce JA. DIP original experiment: DIP-262382X Nature cell biology 2014 IMEx Analysis of tumour- and stroma-supplied proteolytic networks reveals a brain-metastasis-promoting role for cathepsin S. Sevenich L., Bowman RL., Mason SD., Quail DF., Rapaport F., Elie BT., Brogi E., Brastianos PK., Hahn WC., Holsinger LJ., Massagué J., Leslie CS., Joyce JA. Only protein-protein interactions imex curation sevenich-2014-4 in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot Sevenich L., Bowman RL., Mason SD., Quail DF., Rapaport F., Elie BT., Brogi E., Brastianos PK., Hahn WC., Holsinger LJ., Massagué J., Leslie CS., Joyce JA. DIP original experiment: DIP-262381X Nature cell biology 2014 IMEx Analysis of tumour- and stroma-supplied proteolytic networks reveals a brain-metastasis-promoting role for cathepsin S. Sevenich L., Bowman RL., Mason SD., Quail DF., Rapaport F., Elie BT., Brogi E., Brastianos PK., Hahn WC., Holsinger LJ., Massagué J., Leslie CS., Joyce JA. Only protein-protein interactions imex curation sevenich-2014-5 in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot Sevenich L., Bowman RL., Mason SD., Quail DF., Rapaport F., Elie BT., Brogi E., Brastianos PK., Hahn WC., Holsinger LJ., Massagué J., Leslie CS., Joyce JA. DIP original experiment: DIP-262379X Nature cell biology 2014 IMEx Analysis of tumour- and stroma-supplied proteolytic networks reveals a brain-metastasis-promoting role for cathepsin S. Sevenich L., Bowman RL., Mason SD., Quail DF., Rapaport F., Elie BT., Brogi E., Brastianos PK., Hahn WC., Holsinger LJ., Massagué J., Leslie CS., Joyce JA. Only protein-protein interactions imex curation jam3_mouse Junctional adhesion molecule C Jam3 Junctional adhesion molecule 3 JAM-2 protein protein mouse Mus musculus Mouse MALSRRLRLRLYARLPDFFLLLLFRGCMIEAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLNIAGIIGGVLVVLIVLAVITMGICCAYRRGCFISSKQDGESYKSPGKHDGVNYIRTSEEGDFRHKSSFVI mint May participate in cell-cell adhesion distinct from tight junctions p25774-1 Cathepsin S CTSS protein protein human Homo sapiens Human MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI jam1_mouse Junctional adhesion molecule A F11r Jam1 Jcam Jcam1 Junctional adhesion molecule 1 protein protein mouse Mus musculus Mouse MGTEGKAGRKLLFLFTSMILGSLVQGKGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSTRSEGEFKQTSSFLV mint Seems to plays a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly. Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Involved in platelet activation cld3_human Claudin-3 CLDN3 C7orf1 CPETR2 Clostridium perfringens enterotoxin receptor 2 Rat ventral prostate.1 protein homolog protein protein human Homo sapiens Human MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV q16625-1 Occludin OCLN WT-OCLN TM4(+) protein protein human Homo sapiens Human MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT jam2_mouse Junctional adhesion molecule B Jam2 Vejam Junctional adhesion molecule 2 Vascular endothelial junction-associated molecule protein protein mouse Mus musculus Mouse MARSPQGLLMLLLLHYLIVALDYHKANGFSASKDHRQEVTVIEFQEAILACKTPKKTTSSRLEWKKVGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQGQNLQEDKVMLEVLVAPAVPACEVPTSVMTGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNPKGGTHNNSSYTMNTKSGILQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLNISGIIATVVVVAFVISVCGLGTCYAQRKGYFSKETSFQKGSPASKVTTMSENDFKHTKSFII ctss-jam3-1 3268515 N/A 3268520 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 32-241 Region 32-241 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3268521 enzyme enzyme unspecified role unspecified role Region 109-331 Region 109-331 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse protein cleavage protein cleavage false false false ctss-f11r-1 3268516 N/A 3268522 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 27-242 Region 27-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3268521 enzyme enzyme unspecified role unspecified role Region 109-331 Region 109-331 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse protein cleavage protein cleavage false false false cldn3-ctss-1 3268517 N/A 3268523 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3268521 enzyme enzyme unspecified role unspecified role Region 109-331 Region 109-331 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse protein cleavage protein cleavage false false false ctss-ocln-1 3268518 N/A 3268524 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3268521 enzyme enzyme unspecified role unspecified role Region 109-331 Region 109-331 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse protein cleavage protein cleavage false false false ctss-jam2-1 3268519 N/A 3268525 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 26-236 Region 26-236 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3268521 enzyme enzyme unspecified role unspecified role Region 109-331 Region 109-331 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse protein cleavage protein cleavage false false false