DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ laganowsky-2014-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Laganowsky A., Reading E., Allison TM., Ulmschneider MB., Degiacomi MT., Baldwin AJ., Robinson CV. DIP original experiment: DIP-260779X Nature 2014 IMEx Membrane proteins bind lipids selectively to modulate their structure and function. Laganowsky A., Reading E., Allison TM., Ulmschneider MB., Degiacomi MT., Baldwin AJ., Robinson CV. Only protein-protein interactions imex curation laganowsky-2014-2 ecolx Escherichia coli ion mobility mass spec ion mobility mass spectrometry of complexes ion mobility mass spec predetermined predetermined participant predetermined Laganowsky A., Reading E., Allison TM., Ulmschneider MB., Degiacomi MT., Baldwin AJ., Robinson CV. DIP original experiment: DIP-260780X Nature 2014 IMEx Membrane proteins bind lipids selectively to modulate their structure and function. Laganowsky A., Reading E., Allison TM., Ulmschneider MB., Degiacomi MT., Baldwin AJ., Robinson CV. Only protein-protein interactions imex curation laganowsky-2014-3 ecolx Escherichia coli ion mobility mass spec ion mobility mass spectrometry of complexes ion mobility mass spec predetermined predetermined participant predetermined Laganowsky A., Reading E., Allison TM., Ulmschneider MB., Degiacomi MT., Baldwin AJ., Robinson CV. DIP original experiment: DIP-260781X Nature 2014 IMEx Membrane proteins bind lipids selectively to modulate their structure and function. Laganowsky A., Reading E., Allison TM., Ulmschneider MB., Degiacomi MT., Baldwin AJ., Robinson CV. Only protein-protein interactions imex curation laganowsky-2014-4 ecolx Escherichia coli ion mobility mass spec ion mobility mass spectrometry of complexes ion mobility mass spec predetermined predetermined participant predetermined Laganowsky A., Reading E., Allison TM., Ulmschneider MB., Degiacomi MT., Baldwin AJ., Robinson CV. DIP original experiment: DIP-260782X Nature 2014 IMEx Membrane proteins bind lipids selectively to modulate their structure and function. Laganowsky A., Reading E., Allison TM., Ulmschneider MB., Degiacomi MT., Baldwin AJ., Robinson CV. Only protein-protein interactions imex curation amtb_ecoli Ammonium transporter AmtB ybaG JW0441 b0451 amtB Ammonia channel AmtB Ammonium channel AmtB protein protein ecoli Escherichia coli (strain K12) MKIATIKTGLASLAMLPGLVMAAPAVADKADNAFMMICTALVLFMTIPGIALFYGGLIRGKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLMLKNIELTAVMGSIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYIPIAHMVWGGGLLASHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPMVFTGTAILYIGWFGFNAGSAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLLGACSGAIAGLVGVTPACGYIGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVHGVCGIVGCIMTGIFAASSLGGVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLADLTVGLRVPEEQEREGLDVNSHGENAYNA aqpz_ecoli Aquaporin Z aqpZ bniP b0875 Bacterial nodulin-like intrinsic protein JW0859 protein protein ecoli Escherichia coli (strain K12) MFRKLAAECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISGGHFNPAVTIGLWAGGRFPAKEVVGYVIAQVVGGIVAAALLYLIASGKTGFDAAASGFASNGYGEHSPGGYSMLSALVVELVLSAGFLLVIHGATDKFAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVGGIIGGLIYRTLLEKRD 3BDE1A932D45CF14 mscl_myctu Large-conductance mechanosensitive channel mscL MTV044.13c Rv0985c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTNGDSPGRHGGRGTPSPTDGPRASTESQ D682D3F2C1651E9C amtb-4 3266828 N/A 3266832 unspecified role unspecified role unspecified role unspecified role Region 26-428 Region 26-428 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false amtb-5 3266829 N/A 3266832 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false aqpz-4 3266830 N/A 3266833 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mscl-15 3266831 N/A 3266834 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false