DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ moharana-2014-1 in vitro In vitro field flow fractionation field flow fractionation predetermined predetermined participant predetermined Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. DIP original experiment: DIP-261930X Structure (London, England : 1993) 2014 IMEx Structural and mechanistic paradigm of leptin receptor activation revealed by complexes with wild-type and antagonist leptins. Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. Only protein-protein interactions imex curation moharana-2014-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. DIP original experiment: DIP-261928X Structure (London, England : 1993) 2014 IMEx Structural and mechanistic paradigm of leptin receptor activation revealed by complexes with wild-type and antagonist leptins. Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. Only protein-protein interactions imex curation moharana-2014-3 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. DIP original experiment: DIP-261932X Structure (London, England : 1993) 2014 IMEx Structural and mechanistic paradigm of leptin receptor activation revealed by complexes with wild-type and antagonist leptins. Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. Only protein-protein interactions imex curation moharana-2014-4 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. DIP original experiment: DIP-261931X Structure (London, England : 1993) 2014 IMEx Structural and mechanistic paradigm of leptin receptor activation revealed by complexes with wild-type and antagonist leptins. Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. Only protein-protein interactions imex curation moharana-2014-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. DIP original experiment: DIP-261929X Structure (London, England : 1993) 2014 IMEx Structural and mechanistic paradigm of leptin receptor activation revealed by complexes with wild-type and antagonist leptins. Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. Only protein-protein interactions imex curation moharana-2014-6 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. DIP original experiment: DIP-261933X Structure (London, England : 1993) 2014 IMEx Structural and mechanistic paradigm of leptin receptor activation revealed by complexes with wild-type and antagonist leptins. Moharana K., Zabeau L., Peelman F., Ringler P., Stahlberg H., Tavernier J., Savvides SN. Only protein-protein interactions imex curation lepr_mouse Leptin receptor Lepr Db Obr OB receptor B219 protein protein mouse Mus musculus Mouse MMCQKFYVVLLHWEFLYVIAALNLAYPISPWKFKLFCGPPNTTDDSFLSPAGAPNNASALKGASEAIVEAKFNSSGIYVPELSKTVFHCCFGNEQGQNCSALTDNTEGKTLASVVKASVFRQLGVNWDIECWMKGDLTLFICHMEPLPKNPFKNYDSKVHLLYDLPEVIDDSPLPPLKDSFQTVQCNCSLRGCECHVPVPRAKLNYALLMYLEITSAGVSFQSPLMSLQPMLVVKPDPPLGLHMEVTDDGNLKISWDSQTMAPFPLQYQVKYLENSTIVREAAEIVSATSLLVDSVLPGSSYEVQVRSKRLDGSGVWSDWSSPQVFTTQDVVYFPPKILTSVGSNASFHCIYKNENQIISSKQIVWWRNLAEKIPEIQYSIVSDRVSKVTFSNLKATRPRGKFTYDAVYCCNEQACHHRYAELYVIDVNINISCETDGYLTKMTCRWSPSTIQSLVGSTVQLRYHRRSLYCPDSPSIHPTSEPKNCVLQRDGFYECVFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSNVKAEITVNTGLLKVSWEKPVFPENNLQFQIRYGLSGKEIQWKTHEVFDAKSKSASLLVSDLCAVYVVQVRCRRLDGLGYWSNWSSPAYTLVMDVKVPMRGPEFWRKMDGDVTKKERNVTLLWKPLTKNDSLCSVRRYVVKHRTAHNGTWSEDVGNRTNLTFLWTEPAHTVTVLAVNSLGASLVNFNLTFSWPMSKVSAVESLSAYPLSSSCVILSWTLSPDDYSLLYLVIEWKILNEDDGMKWLRIPSNVKKFYIHDNFIPIEKYQFSLYPVFMEGVGKPKIINGFTKDAIDKQQNDAGLYVIVPIIISSCVLLLGTLLISHQRMKKLFWDDVPNPKNCSWAQGLNFQKPETFEHLFTKHAESVIFGPLLLEPEPISEEISVDTAWKNKDEMVPAAMVSLLLTTPDPESSSICISDQCNSANFSGSQSTQVTCEDECQRQPSVKYATLVSNDKLVETDEEQGFIHSPVSNCISSNHSPLRQSFSSSSWETEAQTFFLLSDQQPTMISPQLSFSGLDELLELEGSFPEENHREKSVCYLGVTSVNRRESGVLLTGEAGILCTFPAQCLFSDIRILQERCSHFVENNLSLGTSGENFVPYMPQFQTCSTHSHKIMENKMCDLTV lep_mouse Leptin Lep Ob Obesity factor protein protein mouse Mus musculus Mouse MCWRPLCRFLWLWSYLSYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC lep-lepr-1 3266757 N/A 3266763 unspecified role unspecified role unspecified role unspecified role Region 22-839 Region 22-839 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3266764 unspecified role unspecified role unspecified role unspecified role Region 22-167 Region 22-167 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lep-lepr-2 3266758 N/A 3266763 unspecified role unspecified role unspecified role unspecified role Region 22-839 Region 22-839 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3266764 unspecified role unspecified role unspecified role unspecified role Region 22-167 Region 22-167 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lep-lepr-3 3266759 N/A 3266763 unspecified role unspecified role unspecified role unspecified role Region 22-839 Region 22-839 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3266764 unspecified role unspecified role unspecified role unspecified role Region 22-167 Region 22-167 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lep-lepr-4 3266760 N/A 3266763 unspecified role unspecified role unspecified role unspecified role Region 22-839 Region 22-839 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3266764 unspecified role unspecified role unspecified role unspecified role Region 22-167 Region 22-167 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lep-lepr-5 3266761 N/A 3266763 unspecified role unspecified role unspecified role unspecified role Region 22-839 Region 22-839 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3266764 unspecified role unspecified role unspecified role unspecified role Region 22-167 Region 22-167 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lep-lepr-6 3266762 N/A 3266763 unspecified role unspecified role unspecified role unspecified role Region 22-839 Region 22-839 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3266764 unspecified role unspecified role unspecified role unspecified role Region 22-167 Region 22-167 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false