DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jonas-2014-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265609X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation jonas-2014-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265607X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation jonas-2014-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265616X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation jonas-2014-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265613X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation jonas-2014-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265611X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation jonas-2014-6 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265610X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation jonas-2014-7 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265608X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation jonas-2014-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265614X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation jonas-2014-9 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265617X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation jonas-2014-10 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265612X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation jonas-2014-11 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. DIP original experiment: DIP-265615X Nature structural & molecular biology 2014 IMEx An asymmetric PAN3 dimer recruits a single PAN2 exonuclease to mediate mRNA deadenylation and decay. Jonas S., Christie M., Peter D., Bhandari D., Loh B., Huntzinger E., Weichenrieder O., Izaurralde E. Only protein-protein interactions imex curation pan3_neucr PAN2-PAN3 deadenylation complex subunit pan3 par-2 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 3 pan3 NCU01929 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MAATRYNSGDLRRQVGSPRAKNRDTKETLCRNVVIYGHCRWEDSGCTFNHDQNKASVSQTDLNSNRRVFNVESPSFTPANQQQSAGKKSTFSSQAASAAPFTPRGVGTSTPTLQQANDSTIFNPAAIREFTPQNYDVGNTISQNGAQHVTQDGGLYSDPFSISSLGQTMPPQGQYNPYANDPNNLAGAGAGLYQPAGFGNGLVHPPNYHLYQPPSELYRPSLQPYQRTTYDFFIPKDRRENLQKKLFHMQQLLPNSGLPNLDRWHSLFPLDTKATRNSTCFGYPSWMYKAQNNKNGRHFALRRIEGYRLTNEKAILNVTKEWKKIINANIVTVHEAFTTEFFGDSSLIFVYDFHPLSETLYDHHFPPNNSHNRLRNTNKIPENLLWSYVCQIANALLAIHNAKLAARCLELSKIIWENNRIRLAACSILDVLHHDSPNRKTIEELQQEDFVKFGRIILALATNTPTLNFNNIDAALATIVPRYSTQLRGVLEWLIKPSAPGETKTVETLLGGITTHLANFANFVMQESDEKEFHLMRELENGRIARLMFKLSVVNERGDSCGVHNWSETGERLLLKLFRDYVFHQVDADGKARLDTNHYLNCLSKLDASSEEQILLTSRDNATVFVVSYRSIRQMLDRAYGELGKESKPSATGATI pan2_neucr PAN2-PAN3 deadenylation complex catalytic subunit pan2 par-1 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 2 pan2 NCU04792 NCU10733 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTEIGIPPRLPDPPQPSLLPPDPDMLEELPLSRIGLPYYREQLFSALPPDIISDVGAPPQQIDPNILSTLTKTDWGYIGPNKTGLQRNQYMDTRSTMKTSNTIRAPKFLSEKARESQTGSEDNTLATNETAMMTPNNDHWSLRPEAPPEYRICEIKYSKFGVDDFDFGFFNNTPYPGLENNITNSYANSLLQVMHYTPLLRNMALQHAATACLADPCLLCELGYVFDMLQKGEGPSCHATNMLRALNHTSNASVSGVLEDIAKDKNPSTLVKNLTMFLFDKISQDYKGTPPISTELERTLFKLNQPPNPLDLVKRLLETDARYQIKCMHCQHVSPRTATTFVNKLCYPAAKPNIRGMKAQRITFSQVLKAGLENEAVNKGYCTKCQRYQNLDQRKIIFNIPAVLALCTEITTAEHRKLWSTPGWLPEEIGIIVDQGHVYCYEGDDLKLHLNRGIHNITVYSLVGTVVNVETKSPQKSHLVATVNVGRAEPESKDQDRWHLFNDFSVRGISKVEALTFNAAWKMPVVVMFQVKAANHRFNMDWKTRLDTSVLFRDNNPHALKTYELLDRETEIPGPDTVIAIDTEFIRLKEREIHIDEDGKSKTIRPISHAIARASVVRGQGSREGVAFIDDYIHIKETIVDYLTEWSGITPTDLDPINSQRNLVSPKTAYKKLWVLVNLGCKFLGHGLSQDFRVINIQVPRNQVIDTSIIFMKPPSQRKISLAFLAWYLLKEDIQQNTHDSIEDAQTALKLYRKYEEFMANGSFHDVLEALYKKGKTLNFKPPRISTGAAKDAGFGAVHRVGTPPVPAPGTTEGSFEISNSSTATTGGSALSATGGMGSASASSSMPSTPVRKPIGLGGPFTVAGVVKPSPATSLDNFGAGAVGTGITTAAATMGGGYGGYGTDGAYWGGPNDMAPTSMIGGSAFIPAKFPPGPPETRGFIPYRPQVLLAEREAAAAAAAAAAAAAANNDVGGRGGVACGNGGAGGEQGKQE pan3_chatd PAN2-PAN3 deadenylation complex subunit PAN3 Poly(A)-nuclease deadenylation complex subunit 3 CTHT_0011660 PAN3 PAB1P-dependent poly(A)-specific ribonuclease protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAPLDLTRGQTDACSTENKDILCRNVLIYGHCRYEDQGCTYNHDQNKNSSQPEAPSKKMFNVDSPSFTPSGQSTVLPKKTTLSSQAASAAPFTPRGGGTPTLQTTAESTMFNPAAIREFTPQNYDLGNNNANGISQENGLYPDPFTMSTMGTALPTAGQYNLPLYGDHSGLAAPGAPFYPPHAAYPTGPIQPPHYHLYQPFGPYRQELQPWQRATYDFFMPQNLREDLQKKQFATLQVIPNSGLPQLEHWHSLVPLDTSNRKNTSCFGYPSWVYKAQNSRNGRHYALRRLEGYRLTNEKAILNVMKDWKKIKNASIVTIHEVFTTREFGDSSLIFAYDFHPLSKTLQEHHFQPIHGNRYRPPPAVPENTIWGYICQIANALKTIHSNRLAARCLEPSKIILTDINRIRLSACAILDVVQFGMNSRSVVELQQEDFVKFGKLILSLATGTLPAHLNNIPAALETLGNKYSANLKSAVNWLLDTSSGETKTIEHFMTGIASQMTTFFDLALQDNDEKLFHLAREVENGRIARSLMKLLTILERGDYDGVPSWSETGDRYQLKLFRDYVFHRVDADGKPNLSIGHMLTCMSKLEAGVDENILLTSRDNETVFVLSYRELRQMYDRAFNELVKASKTGAPGANT pan2_chatd PAN2-PAN3 deadenylation complex catalytic subunit PAN2 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 2 CTHT_0042640 PAN2 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MDADWDEVTRIAYPAPGTNDFPRPATAVAFDPIAELLWAGFDRGRVCSFYGRDLTRYTAFKIQPASEGPVRQFLFHDKGVIVLGTRSVHMAMRRGPALWNIRHENMKDLRCMSFTSKGTQEIIVAGWQDTMLVIDVLKGDIIKQIPAQHHYSIMKKSRYICAATKTGSVDLIDPLSFKIVRSWQAHASYINDMDAQNDFIVTCGGSLKQQAAQTYMLDPYVNVFDLKNMASMKPMPFPPLAAHVRLHPRMLTTAIVTSQHGQMHVVDIMNPNSSTVRYANISSYVKLFEIAPSGEALVIGDADCNIHLWGSPTKIHFTDMAIPIELPEPEEPAPVLDWSIETPLSSIGLPYYREPLFSAWPADIISDVGAPPLQLEPSFVATLKQAEWGLYGKNTRNVRRNQVEDTRNTNKQSNALQAPKFLSERARESALSSGGDSSSDPQVDQEPEDPNEIESLKPEAPPLYRNLEIKYSKFGVDDFDFGYYNKTRYAGLENHIPNSYANSLLQLMHYTPLLRNMALQHAATACVSDLCLLCELGFVFDMLQKAEGATCQATNMFKALSGTPQAAPLGLLEEETHVPSLATMAQNLSRFLLEKIHNEYRTIPPISTALEQSLFNFPHPPTPDELVAKVLATSAVATIKCMNCRSETTRPGTTHVIDLLYPPPKTAGRGGRASKVTFSQVLKMGVERETTSKGWCSRCQRYQNLQMRKTIHSVPAVLVVNAGVSNQEHRKLWSTPGWLPEEIGIIVDQGQFFCFEGEDLKLHLQRGIHNITVYSLIGMVINIESHSPQKSHLVGIINVAHAEATPPGENKWHLFNDFSVRPVSAAEALTFNAAWKMPAVLLFQIKSANNKSNLDWKTNLDTSILYKDTNPNTEKKTYRTLDQERERPGPDTIVALDTEFVSLKQPEIQMNSDGERETIRPMSHALARVSVVRGQGENEGSAFIDDYIAIREPVVDYLTLYSGITASDLDPRTSKHNLVSLKTAYKKLWVLLNLGCKFLGHGLKQDFRVINIQVPRAQVIDTIEVFYLKSRLRKLSLAFLAWYLLKEDIQLETHDSIEDARTALKLYRKYLEFDDAGILEAMLEDIYKAGRATNFKPPRREDREKELQRQSTPPNSTAPNDCGAKPDGNGNENGGEPATPARKTGGITAPTFGAVNVFGTPSKASSPLPK pan3_human PAN2-PAN3 deadenylation complex subunit PAN3 PAN3 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 3 protein protein human Homo sapiens Human MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCRYYAKDKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVAGFPPGAVAGGGAGPPPGPKKPDLGDPGTGAAAGGGGSSGGLDGPRLAIPGMDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKYPLMQRMTNSSSSPSLLNDSAKPYSAHDPLTSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQHEGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL q504q3-2 PAN2-PAN3 deadenylation complex catalytic subunit PAN2 PAN2 Inactive ubiquitin carboxyl-terminal hydrolase 52 KIAA0710 USP52 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 2 protein protein human Homo sapiens Human MNFEGLDPGLAEYAPAMHSALDPVLDAHLNPSLLQNVELDPEGVALEALPVQESVHIMEGVYSELHSVVAEVGVPVSVSHFDLHEEMLWVGSHGGHATSFFGPALERYSSFQVNGSDDIRQIQSLENGILFLTKNNLKYMARGGLIIFDYLLDENEDMHSLLLTDSSTLLVGGLQNHIIEIDLNTVQETQKYAVETPGVTIMRQTNRFFFCGHTSGKVSLRDLRTFKVEHEFDAFSGSLSDFDVHGNLLAACGFSSRLTGLACDRFLKVYDLRMMRAITPLQVHVDPAFLRFIPTYTSRLAIISQSGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSASKQALAFGDSEGCVHLWTDSPEPSFNPYSRETEFALPCLVDSLPPLDWSQDLLPLSLIPVPLTTDTLLSDWPAANSAPAPRRAPPVDAEILRTMKKVGFIGYAPNPRTRLRNQIPYRLKESDSEFDSFSQVTESPVGREEEPHLHMVSKKYRKVTIKYSKLGLEDFDFKHYNKTLFAGLEPHIPNAYCNCMIQVLYFLEPVRCLIQNHLCQKEFCLACELGFLFHMLDLSRGDPCQGNNFLRAFRTIPEASALGLILADSDEASGKGNLARLIQRWNRFILTQLHQDMQELEIPQAYRGAGGSSFCSSGDSVIGQLFSCEMENCSLCRCGSETVRASSTLLFTLSYPDDKTGKNYDFAQVLKRSICLDQNTQAWCDTCEKYQPTIQTRNIRHLPDILVINCEVNSSKEADFWRMQAEVAFKMAVKKHGGEISKNKEFALADWKELGSPEGVLVCPSIEELKNVWLPFSIRMKMTKNKGLDVCNWTDGDEMQWGPARAEEEHGVYVYDLMATVVHILDSRTGGSLVAHIKVGETYHQRKEGVTHQQWYLFNDFLIEPIDKHEAVQFDMNWKVPAILYYVKRNLNSRYNLNIKNPIEASVLLAEASLARKQRKTHTTFIPLMLNEMPQIGDLVGLDAEFVTLNEEEAELRSDGTKSTIKPSQMSVARITCVRGQGPNEGIPFIDDYISTQEQVVDYLTQYSGIKPGDLDAKISSKHLTTLKSTYLKLRFLIDIGVKFVGHGLQKDFRVINLMVPKDQVLDTVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL pan3_drome PAN2-PAN3 deadenylation complex subunit PAN3 PAN3 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 3 CG11486 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MCSTYGLLSFEFSDTAAMDPIFFSPTNGIPSESKLATYMNRQNVATPSGYGLNNGFSLLNLDSPLNKKSQVTPQSPEFIPTRLGSTPNFYAPYHNAPMQLSNGLNGVNGLTAAAAAAAAAAAAAAAAVPSSTSSASSASVTISKTANGGASMLALQKTASIASVTIAQQQPQHPQKQQQHPPSVGGGAVSAASAPIAISGAPPNPAAAPFVSSMSAQTPLKGRGAMMRQESPTAAMISGAGPGEKSPPHGMTPHGASPIPSALPTSVHQENVGGTIYFYPTANAQNSQPVVNSMVVDGTHPALHGVSAVAPMSAGVPAAMMYTGHVYPGPSSNVVTMQPKTLLESAFFMPDEMRAEVLARNEISNLIMDAAEAAQHALPLEVENYHALYPLEPPAQPLHAKLTFPATTYRATHNTTGYKYCLRRIHGFRLQSTKCMTLVEMWKKLQHTNVVQLREVFTTKAFGDNSLVLVYDYHPGSQTLLAKYFTPAPETNGYTDPFQGEARPFSHKSNMQRTSNGPLLPEATIWSIIMQLTAGLKAIHHAGLACKVLDPTKIIVTGKRVRFSSCCISDITQFDPNASNPLALVNMHQQDDLTALGRLVLALACRCLQSVQRDNVQSSIDMVTRNYSTDLRNFIVYLFTTNNRRSVTDLMPMIGARFYTQLDALQSKIDMQEDELAKEMENGRLYRILVKLNSINERPDFNLDCTWSETGDRYMLKLFRDYLFHSVTEDGRPWLDHAHIVQCLNKLDAGSIERVQLMSRDEQSVLIVSYAELKNCLENAFSELMSSAAN pan2_drome PAN2-PAN3 deadenylation complex catalytic subunit PAN2 PAN2 PAB1P-dependent poly(A)-specific ribonuclease Poly(A)-nuclease deadenylation complex subunit 2 CG8232 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDYVYCGTDPIGASEDILSVYDAGSAPGNGHFSPSFNGFNIGTTDPEYVELVPVLADGGEHFGVSSVAFDDYEELLWMGNQGGHVTSYYTNSMQKYTSFQVHATDIVRDISTLDSGVLALTQTSLRHQIRRGLPKFTFKSNNMKEMVSMLQLSPHRLVMAGLQDELIDFDLRTLKETRIEHVGAGGCTVLRKNSRYLFAGDQLGTVTLRDLNSLSVQHTIKTHTNILSDFSVQGNLLISCGYSGRQNNLAIDRFLMVYDLRMLRLIAPIQVMIDPQMLKFLPSLTSQLAVVSSYGQVQLVDTVELSEPRVSMYQINTNGSQCLSFDISSSSQAMAFGDQSGHINMIAAVQTPQPQFNLYSRSTEFADVVPQLPMVSITDTNFPLSSVMLPHLTTGTQWFSDWPEELLRYRYHRPKTIDPEVLSNMKMQGPIGYSPNPRTARRNQIPYVIEQGGVCSPNGNGTAAATKAENGVKIIPRRYRKVELKYTKLGTQDFDFDQHNQTCFAGLEATLPNSYCNAMLQILYFTDALRVKLLEHSCIKEFCLSCELGFLFNMLDKSTASSPCQASNFLRSFRTVPEASALGLILTDRSSNVNLISLIQNWNRFILHQMHYEIFDSSKNASTYSGSVQTSTNAENAGSSETSGSSDLYDSISDENSKEDDRERSKINAETDISKIFGTKQICINRCIKCQEEKIKESILLACNLSYPNHIKDSDQYFNFGTILKRSLSSEKSIQAFCERCKKFSPTNQSVKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLSTSKPCRYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTMGINDQGEVQVQTQSDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQVDDGTQKNLVSLINVQRPYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVWFTLDWKVPCILFYRHVEDDSESASTTSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMVSLRFLAWHFLGTKIQSETHDSIEDARTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQWKVPED pan2-pan3-2 3266586 N/A 3266597 unspecified role unspecified role unspecified role unspecified role Region 538-656 Region 538-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266598 unspecified role unspecified role unspecified role unspecified role Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false g0s0y3_chatd-pan2-1 3266587 n/a 3266599 unspecified role unspecified role unspecified role unspecified role Region 448-555 Region 448-555 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266600 unspecified role unspecified role unspecified role unspecified role Region 1-457 Region 1-457 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pan2-pan3-7 3266588 N/A 3266597 unspecified role unspecified role prey prey Region 234-656 Region 234-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q7SDP4:p.Val627Glu V627E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266598 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false pan2-pan3-8 3266589 N/A 3266601 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3266602 unspecified role unspecified role bait bait Region 1-433 Region 1-433 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false pan2-pan3-9 3266590 N/A 3266597 unspecified role unspecified role unspecified role unspecified role Region 538-656 Region 538-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266598 unspecified role unspecified role unspecified role unspecified role Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pan2-pan3-10 3266591 N/A 3266597 unspecified role unspecified role unspecified role unspecified role Region 538-656 Region 538-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266598 unspecified role unspecified role unspecified role unspecified role Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false g0s0y3_chatd-pan2-2 3266592 n/a 3266599 unspecified role unspecified role unspecified role unspecified role Region 448-555 Region 448-555 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266600 unspecified role unspecified role unspecified role unspecified role Region 1-457 Region 1-457 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pan2-pan3-11 3266593 N/A 3266597 unspecified role unspecified role prey prey Region 234-656 Region 234-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3266598 unspecified role unspecified role bait bait Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P0C581:p.Phe62Glu F62E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P0C581:p.Gly97Glu G97E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P0C581:p.Thr60Arg T60R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P0C581:p.Pro99Arg P99R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false pan3_drome-pan2-1 3266594 N/A 3266603 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q95RR8:p.[Trp707Ala;Gly711Glu;Tyr722Ala;His739Ala;Arg754Ala] Y722A/H739A/R754A/W707A/G711E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q95RR8:p.[Tyr722Ala;His739Ala;Arg754Ala] Y722A/H739A/R754A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3266604 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false pan2-pan3-12 3266595 N/A 3266597 unspecified role unspecified role unspecified role unspecified role Region 234-656 Region 234-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266598 unspecified role unspecified role unspecified role unspecified role Region 1-351 Region 1-351 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pan2-pan3_drome-1 3266596 N/A 3266603 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3266604 unspecified role unspecified role bait bait Region 1-468 Region 1-468 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 1-376 Region 1-376 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 358-467 Region 358-467 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false A1Z7K9:p.[Thr97Arg;His102Gly] T97R/H102G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false