DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ simon-2014-1 in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation weight silver stain molecular weight estimation by silver staining weight silver stain Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260817X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-2 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260811X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260796X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-4 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260805X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-5 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260797X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-6 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260798X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-7 ecolx Escherichia coli density sedimentation cosedimentation through density gradient density sedimentation weight silver stain molecular weight estimation by silver staining weight silver stain Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260816X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-8 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260799X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-9 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260812X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260820X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-11 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260800X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-12 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260806X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-13 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260807X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-14 in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation weight silver stain molecular weight estimation by silver staining weight silver stain Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260818X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-15 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260801X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-16 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260814X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-17 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260813X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260819X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260802X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-20 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260808X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-21 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260803X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-22 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260809X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-23 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260804X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-24 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260810X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation simon-2014-25 in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation weight silver stain molecular weight estimation by silver staining weight silver stain Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. DIP original experiment: DIP-260815X Nature 2014 IMEx A Ctf4 trimer couples the CMG helicase to DNA polymerase α in the eukaryotic replisome. Simon AC., Zhou JC., Perera RL., van Deursen F., Evrin C., Ivanova ME., Kilkenny ML., Renault L., Kjaer S., Matak-Vinković D., Labib K., Costa A., Pellegrini L. Only protein-protein interactions imex curation dpoa_yeast DNA polymerase alpha catalytic subunit A POL1 CDC17 DNA polymerase alpha:primase complex p180 subunit DNA polymerase I subunit A N2181 YNL102W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSKSEKLEKLRKLQAARNGTSIDDYEGDESDGDRIYDEIDEKEYRARKRQELLHDDFVVDDDGVGYVDRGVEEDWREVDNSSSDEDTGNLASKDSKRKKNIKREKDHQITDMLRTQHSKSTLLAHAKKSQKKSIPIDNFDDILGEFESGEVEKPNILLPSKLRENLNSSPTSEFKSSIKRVNGNDESSHDAGISKKVKIDPDSSTDKYLEIESSPLKLQSRKLRYANDVQDLLDDVENSPVVATKRQNVLQDTLLANPPSAQSLADEEDDEDSDEDIILKRRTMRSVTTTRRVNIDSRSNPSTSPFVTAPGTPIGIKGLTPSKSLQSNTDVATLAVNVKKEDVVDPETDTFQMFWLDYCEVNNTLILFGKVKLKDDNCVSAMVQINGLCRELFFLPREGKTPTDIHEEIIPLLMDKYGLDNIRAKPQKMKYSFELPDIPSESDYLKVLLPYQTPKSSRDTIPSDLSSDTFYHVFGGNSNIFESFVIQNRIMGPCWLDIKGADFNSIRNASHCAVEVSVDKPQNITPTTTKTMPNLRCLSLSIQTLMNPKENKQEIVSITLSAYRNISLDSPIPENIKPDDLCTLVRPPQSTSFPLGLAALAKQKLPGRVRLFNNEKAMLSCFCAMLKVEDPDVIIGHRLQNVYLDVLAHRMHDLNIPTFSSIGRRLRRTWPEKFGRGNSNMNHFFISDICSGRLICDIANEMGQSLTPKCQSWDLSEMYQVTCEKEHKPLDIDYQNPQYQNDVNSMTMALQENITNCMISAEVSYRIQLLTLTKQLTNLAGNAWAQTLGGTRAGRNEYILLHEFSRNGFIVPDKEGNRSRAQKQRQNEENADAPVNSKKAKYQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQEFNICFTTVDRNKEDIDELPSVPPSEVDQGVLPRLLANLVDRRREVKKVMKTETDPHKRVQCDIRQQALKLTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILMNTRQLAESMNLLVVYGDTDSVMIDTGCDNYADAIKIGLGFKRLVNERYRLLEIDIDNVFKKLLLHAKKKYAALTVNLDKNGNGTTVLEVKGLDMKRREFCPLSRDVSIHVLNTILSDKDPEEALQEVYDYLEDIRIKVETNNIRIDKYKINMKLSKDPKAYPGGKNMPAVQVALRMRKAGRVVKAGSVITFVITKQDEIDNAADTPALSVAERAHALNEVMIKSNNLIPDPQYYLEKQIFAPVERLLERIDSFNVVRLSEALGLDSKKYFRREGGNNNGEDINNLQPLETTITDVERFKDTVTLELSCPSCDKRFPFGGIVSSNYYRVSYNGLQCKHCEQLFTPLQLTSQIEHSIRAHISLYYAGWLQCDDSTCGIVTRQVSVFGKRCLNDGCTGVMRYKYSDKQLYNQLLYFDSLFDCEKNKKQELKPIYLPDDLDYPKEQLTESSIKALTEQNRELMETGRSVVQKYLNDCGRRYVDMTSIFDFMLN 50C9032DBE95B5AE ctf4_yeast DNA polymerase alpha-binding protein CTF4 CHL15 POB1 YPR135W P9659.7 Chromosome transmission fidelity protein 4 Protein POB1 Chromosome replication protein CHL15 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVSVIDKLVFDFGGKTLVSLAPDNNTLCVANKNGLTKILKTNNPEEEPETLDSSKLVSSIKCYSNSHFLMTTMQGDALRYNIDSSQEELLARFALPLRDCCVIHSGKMAVFGGDDLELILLELDDETHKKHAIKIDEQVSQISYNSQMNILAVSMINGKVQIFSLTSTIPNKVHELNDYIVANSYDDTHRDKILSNMMDDIDKDNDNDLSETADPDENNVADPEFCAANRICTRVAWHPKGLHFALPCADDTVKIFSIKGYSLQKTLSTNLSSTKAHFIDLQFDPLRGTYIAAVDLNNKLTVWNWETSEIHYTREFKRKITNIAWKIQADSKTLDLVLGTWSGSIAIVQNLAESVVSNIPDQSVAESSTKHGLFVDSESDLENLEGNDDINKSDKLFSDITQEANAEDVFTQTHDGPSGLSEKRKYNFEDEEDFIDDDDGAGYISGKKPHNEHSYSRVHKTHSFPISLANTGKFRYMPFSPAGTPFGFTDRRYLTMNEVGYVSTVKNSEQYSITVSFFDVGRFREYHFEDLFGYDLCFLNEKGTLFGQSKTGQIQYRPHDSIHSNWTKIIPLQAGERITSVAATPVRVIVGTSLGYFRSFNQFGVPFAVEKTSPIVALTAQNYRVFSVHYSQFHGLSYSLSELGTSSKRYYKRECPLPMSLPNINSDMKKDANLDYYNFNPMGIKSLFFSSYGDPCIFGSDNTLLLLSKWRSPEESKWLPILDSNMEIWKMSGGKETTDIHVWPLALAYDTLNCILVKGKHIWPEFPLPLPSEMEIRMPVFVKSKLLEENKAILNKKNEIGADTEAEEGEEDKEIQIPVSMAAEEEYLRSKVLSELLTDTLENDGEMYGNENEVLAALNGAYDKALLRLFASACSDQNVEKALSLAHELKQDRALTAAVKISERAELPSLVKKINNIREARYEQQLK E2ABBB244B5F8B4D sld5_yeast DNA replication complex GINS protein SLD5 YDR489W SLD5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDINIDDILAELDKETTAVDSTKITQGSSSTTHRDANTIVGSSLDLNDKTQIYVSPQQDFSDLMKSWKNERCSPELLPYPHQLMKRLLNRISMQSQLIENISMGFLDMQNASNANPPMPNESKLPLLCMETELERLKFVIRSYIRCRLSKIDKFSLYLRQLNEDENSLISLTDLLSKDEIKYHDTHSLIWLKLVNDSILKYMPEELQAINDTEGSVNMIDEPDWNKFVFIHVNGPPDGKWNEDPLLQENEFGKPCYTVTIPDLKEEVELTIGSIYVMRYEVIRDLLRDDKVALI 7EC516ADAD9900DD psf3_yeast DNA replication complex GINS protein PSF3 YOL146W Partner of Sld five 3 PSF3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGYYDIDDVLADGTEFPCKFQYDIPGLGYLENNPGRPITKNTKLSLPLWLARILAIVGGDEALVDEEPVPFVELLPPDMFSTKVMNAIKTDPVALDLHSINSHFFSLAIKWIMLFSEKELANVVSELLLQRAQELNHHASSLSIDLNADSTGKNSANTNIATSTFLLKLEEMEKEIYKKSHESYKDTKRWMFKK 3E8B60DFCE16391D psf2_yeast DNA replication complex GINS protein PSF2 PSF2 YJL072C J1086 Partner of Sld five 2 HRF213 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLPAHLQQTFSPEEIQFIVENEPIKIFPRITTRQKIRGDDRGTGNHTRWQLITTDDKALNNMVAMRSTEVVLWIALLLKQQSKCSIVAPQWLTTKELDRKIQYEKTHPDRFSELPWNWLVLARILFNKAKDDFHDPIHELRGKIQDLREIRQIKVLKGLKYLNESHLQLDNLSLLEINELRPFITEIMDKLREIHTASLTAGTENDEEEFNI C8B52C0462A37A3A psf1_yeast DNA replication complex GINS protein PSF1 Partner of Sld five 1 YDR013W YD8119.18 PZA208 PSF1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYGDLGNKLVLEAKRTKQLYARSNQDVNLPMYHEDIIRNILKEVSNLRKNTEYLKEQQQLGMLDDKVAKCQYFVTLLCMERNKRCLLAYQRLRTDILDSMAWNNNGLDLMSSITFSQQDTNNLSHQEQEYLKEYCDLITDLKSGDLVDIDLSGSLVPPSDVFIDVRVLKDAGEIQTEYGVFNLIKDSQFFVRQSDVERLIQQGYLQKI 4667D8152C1AB5B4 mcm2_yeast DNA replication licensing factor MCM2 MCM2 YBL023C YBL0438 Minichromosome maintenance protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPDIDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERDRLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREELTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIRISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFVDAQKVSVRRQLRRSFAIYTLGH F38FF682581B0EC0 mcm6_yeast DNA replication licensing factor MCM6 YGL201C MCM6 Minichromosome maintenance protein 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGPFVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLEDFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPFLQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGNGTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRETELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKELRKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDVDDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKKKTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRLAFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS 03AB793134E64A50 mcm5_yeast Minichromosome maintenance protein 5 MCM5 CDC46 YLR274W L9328.1 Cell division control protein 46 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFDRPEIYSAPVLQGESPNDDDNTEIIKSFKNFILEFRLDSQFIYRDQLRNNILVKNYSLTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQASGTSLSEIRRFEQELKRRLPIGWSTSYQTLRREFVDTHRFSQLALDKALYALEKHETIQLRHQGQNIYRSGV 01D9DE208A091CF2 mcm4_yeast DNA replication licensing factor MCM4 MCM4 HCD21 YPR019W YP9531.13 CDC54 Cell division control protein 54 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQQSSSPTKEDNNSSSPVVPNPDSVPPQLSSPALFYSSSSSQGDIYGRNNSQNLSQGEGNIRAAIGSSPLNFPSSSQRQNSDVFQSQGRQGRIRSSASASGRSRYHSDLRSDRALPTSSSSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRIIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVESSDIQEALSRLQQEDKVIVLGEGVRRSVRLNNRV 382D542AE38975E3 cdc45_yeast Cell division control protein 45 CDC45 YLR103C L8004.11 SLD4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYYGISQFSEAYNKILRNSSSHSSCQLVIFVSCLNIDALCATKMLSLLFKKQLVQSQIVPIFGYSELRRHYSQLDDNINSLLLVGFGGVIDLEAFLEIDPQEYVIDTDEKSGEQSFRRDIYVLDAHRPWNLDNIFGSQIIQCFDDGTVDDTLGEQKEAYYKLLELDEESGDDELSGDENDNNGGDDEATDADEVTDEDEEDEDETISNKRGNSSIGPNDLSKRKQRKKQIHEYEGVLEEYYSQGTTVVNSISAQIYSLLSAIGETNLSNLWLNILGTTSLDIAYAQVYNRLYPLLQDEVKRLTPSSRNSVKTPDTLTLNIQPDYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGKKRLHKMFARMGIPLSTAQETWLYMDHSIKRELGIIFDKNLDRYGLQDIIRDGFVRTLGYRGSISASEFVEALTALLEVGNSTDKDSVKINNDNNDDTDGEEEEDNSAQKLTNLRKRWVSNFWLSWDALDDRKVELLNRGIQLAQDLQRAIFNTGVAILEKKLIKHLRIYRLCVLQDGPDLDLYRNPLTLLRLGNWLIECCAESEDKQLLPMVLASIDENTDTYLVAGLTPRYPRGLDTIHTKKPILNNFSMAFQQITAETDAKVRIDNFESSIIEIRREDLSPFLEKLTLSGLL 6500DDD62EC4E8EE csm3_yeast Chromosome segregation in meiosis protein 3 CSM3 YM9796.01 YMR048W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDQDFDSLLLGFNDSDSVQKDPTVPNGLDGSVVDPTIADPTAITARKRRPQVKLTAEKLLSDKGLPYVLKNAHKRIRISSKKNSYDNLSNIIQFYQLWAHELFPKAKFKDFMKICQTVGKTDPVLREYRVSLFRDEMGMSFDVGTRETGQDLERQSPMVEEHVTSAEERPIVADSFAQDKRNVNNVDYDNDEDDDIYHLSYRNRRGRVLDERGNNETVLNNVVPPKEDLDALLKTFRVQGPVGLEENEKKLLLGWLDAHRKMEKGSMTEEDVQLIQSLEEWEMNDIEGQHTHYDLLPGGDEFGVDQDELDAMKEMGF 0B92F561F91197AE pob3_yeast FACT complex subunit POB3 YML069W Facilitates chromatin transcription complex subunit POB3 POB3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTDFDRIYLNQSKFSGRFRIADSGLGWKISTSGGSAANQARKPFLLPATELSTVQWSRGCRGYDLKINTKNQGVIQLDGFSQDDYNLIKNDFHRRFNIQVEQREHSLRGWNWGKTDLARNEMVFALNGKPTFEIPYARINNTNLTSKNEVGIEFNIQDEEYQPAGDELVEMRFYIPGVIQTNVDENMTKKEESSNEVVPKKEDGAEGEDVQMAVEEKSMAEAFYEELKEKADIGEVAGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHLLVLAIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRAGQTSTSSRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVKNEDREVQERLQTALGSDSDEEDINMGSAGEDDESVDEDFQVSSDNDADEVAEEFDSDAALSDAEGGSDEERPSKKPKVE 02C04F620C7B1450 mcm3_yeast DNA replication licensing factor MCM3 MCM3 YEL032W SYGP-ORF23 Minichromosome maintenance protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEGSTGFDGDATTFFAPDAVFGDRVRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYNDDQDDADERDLLGDDDGDDLEKEKKAASSTSLNILPHRIIISLDDLREFDRSFWSGILVEPAYFIPPAEKALTDLADSMDDVPHPNASAVSSRHPWKLSFKGSFGAHALSPRTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKSLGAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKKSPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFALLGEDIGNDIDEEESEYEEALSKRSPQKSPKKRQRVRQPASNSGSPIKSTPRRSTASSVNATPSSARRILRFQDDEQNAGEDDNDIMSPLPADEEAELQRRLQLGLRVSPRRREHLHAPEEGSSGPLTEVGTPRLPNVSSAGQDDEQQQSVISFDNVEPGTISTGRLSLISGIIARLMQTEIFEEESYPVASLFERINEELPEEEKFSAQEYLAGLKIMSDRNNLMVADDKVWRV 43DD4DACAF4456DC ctf4-pol1-3 3266003 N/A 3266028 unspecified role unspecified role unspecified role unspecified role Region 1-351 Region 1-351 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ctf4-pol1-4 3266004 N/A 3266028 unspecified role unspecified role unspecified role unspecified role Region 1-351 Region 1-351 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266030 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266031 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266032 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266033 unspecified role unspecified role unspecified role unspecified role Region 1-164 Region 1-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ctf4-1 3266005 N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sld5-ctf4-1 3266006 N/A 3266030 unspecified role unspecified role bait bait Region 1-18 Region 1-18 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q03406:p.Ile8Ala I8A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q03406:p.Leu9Ala L9A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3266029 unspecified role unspecified role prey prey Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ctf4-2 3266007 N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ctf4-3 3266008 N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false psf1-psf2-2 3266009 N/A 3266030 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266031 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266032 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266033 unspecified role unspecified role unspecified role unspecified role Region 1-164 Region 1-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ctf4-4 3266010 N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ctf4-pol1-5 3266011 N/A 3266028 unspecified role unspecified role unspecified role unspecified role Region 1-351 Region 1-351 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mcm4-mcm2-1 3266012 N/A 3266034 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266035 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266036 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266037 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false ctf4-5 3266013 N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false psf1-psf2-3 3266014 N/A 3266030 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266031 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266032 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266033 unspecified role unspecified role unspecified role unspecified role Region 1-164 Region 1-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ctf4-psf1-2 3266015 N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266030 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266031 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266032 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266033 unspecified role unspecified role unspecified role unspecified role Region 1-164 Region 1-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ctf4-pol1-6 3266016 N/A 3266028 unspecified role unspecified role unspecified role unspecified role Region 1-351 Region 1-351 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266030 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266031 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266032 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266033 unspecified role unspecified role unspecified role unspecified role Region 1-164 Region 1-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false pol1-ctf4-1 3266017 N/A 3266028 unspecified role unspecified role bait bait Region 137-149 Region 137-149 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P13382:p.Phe140Ala F140A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P13382:p.Asp142Ala D142A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P13382:p.Ile143Ala I143A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P13382:p.Leu144Ala L144A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P13382:p.Phe147Ala F147A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3266029 unspecified role unspecified role prey prey Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ctf4-sld5-1 3266018 N/A 3266030 unspecified role unspecified role unspecified role unspecified role Region 1-19 Region 1-19 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fluorescein-label Fluorescein-label fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ctf4-pol1-7 3266019 N/A 3266028 unspecified role unspecified role unspecified role unspecified role Region 137-149 Region 137-149 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fluorescein-label Fluorescein-label fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mcm4-cdc45-1 3266020 N/A 3266031 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266038 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266033 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266030 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266028 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266029 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266039 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266040 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266034 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266035 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266036 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266037 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pol1-cdc45-1 3266021 N/A 3266029 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266041 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266038 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266033 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266030 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3266028 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false ctf4-pol1-8 3266022 N/A 3266028 unspecified role unspecified role unspecified role unspecified role Region 137-149 Region 137-149 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ctf4-pol1-9 3266023 N/A 3266028 unspecified role unspecified role unspecified role unspecified role Region 137-149 Region 137-149 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ctf4-sld5-2 3266024 N/A 3266030 unspecified role unspecified role unspecified role unspecified role Region 1-19 Region 1-19 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ctf4-sld5-3 3266025 N/A 3266030 unspecified role unspecified role unspecified role unspecified role Region 1-19 Region 1-19 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ctf4-psf1-3 3266026 N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266030 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266031 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266032 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266033 unspecified role unspecified role unspecified role unspecified role Region 1-164 Region 1-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ctf4-psf1-4 3266027 N/A 3266029 unspecified role unspecified role unspecified role unspecified role Region 471-927 Region 471-927 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3266030 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266031 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266032 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3266033 unspecified role unspecified role unspecified role unspecified role Region 1-164 Region 1-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false