DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fujioka-2014-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260910X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260899X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260896X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260906X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260903X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-6 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260900X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260907X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-8 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260897X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-9 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260901X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-10 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260908X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260904X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260898X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-13 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260902X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-14 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260909X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-15 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260911X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation fujioka-2014-16 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. DIP original experiment: DIP-260905X Nature structural & molecular biology 2014 IMEx Structural basis of starvation-induced assembly of the autophagy initiation complex. Fujioka Y., Suzuki SW., Yamamoto H., Kondo-Kakuta C., Kimura Y., Hirano H., Akada R., Inagaki F., Ohsumi Y., Noda NN. Only protein-protein interactions imex curation c5df24_lactc Autophagy-related protein 29 KLTH0D11660g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MNSENTIVYVRVAGRARNGFVDPLKFYWDLERDRSLWSSVSKLDNTKKTIDWKRLSREFKAPEHFIRKRSYALFAKHLKLLERQIEAKTRSLAVTEDELNYTDEDDERNSISHGEDDFEAAEGLKNLRTSKVLKQRVPGEGRNGESSLSELSNLSVSKSALEEALLDRLQL c5deb9_lactc KLTH0C07942g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MSSEANPPVLEPFTVTVVDRNVKHQVEGEPEEEGHPDHEVQGVMFATNVKYIFEDDQELLPEQEDPAIENVVIIEADESLRVTQVELISDQFKQVGYEVRDGNEVCIDALSRFETPRQLGNLPLEKLVQLYKLQNDQLHSLFNTL c5dfj6_lactc Autophagy-related protein 17 KLTH0D15642g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MNEAVIEKLLENSRKFLTGAKLICQESNDHLTTTKLRIREWQKFQSKLHFVLDCIQQQTKFLSEILLREGIGRNLIEEEWSQTVLVRLVNDMKFWQNEITKMMNKLDNITNEIDQQHNSKLGDFISRDSSHILDSKLNEIPTIRKQVENITRQYQTMLAKVQSQLVESRMKGLRDEFSSKFGDQCRENLKLNEEFTNEADQLEQELADFLKSFTDHFDKCSALSSRSVSPEDAQNLFEIVERDDKDLAAINSLLQDAAIDVASFVRKVNMLLDERDADKAKMQATLSKLLTELRKHEEYISVFEGISALIQKFKASCLEDIRQTRNLLDFYANFERSYHNLLKEVKRRKETAAKLSQILKSCETQLEQINTADLRERQMFLLENGNYLPETIWPDEIGSLSPLYTLNYEVRKV atg13_klumd Autophagy-related protein 13 ATG13 KLMA_40473 protein protein kluyveromyces marxianus dmku3-1042 Kluyveromyces marxianus DMKU3-1042 MSDSDREIIGLINNFFLKAALLLEQCKVVARGGGFDGEEPLRDGNHLFNIETRGDPTLEAQIQPWTTFDGEKSMPPLVLETFLDLRGLHSNQTVYLHDSDGNPWMVCKGGKKSEIVLERWLIELDRQFSSTTGSTDAAEDDEYNEFNDPENLHKQLVLLFRYLYTLTQLLPANDIITKLQASQQGTAQATTTTGTLKPLHIHTRLLDGSKPILSKGRVGLSKPIIASYSNTMNETNIASHLEQRKITPIKTKFGSLRITVSYRKDVDFYVIDQEDPYKRTTNVSALQDTVTATDRRISSNSNISISVSPKTTNMLNANHIPVDSSGGGFARRQSISSKLQPFKVGSVGSGSFVQSGSLQSVTNPNPSLSRNVSSSSVAAALKVQRGSAGSTVLNSDLPPELSSVGSGSKYSSSFGRIRRHSSVRRSESIDRTAKPRKSNETPPEDLLEFVKLLEDKKELNMKPSTILPQQDISSSLIKFQSMKPNNDTLSDNLSMSMSIDQPNMRMGSNSHSPIPSFSPNYGSIPSRLSQGSRNNSNVELITSRKSSLDRHRLSLLNRTGSNVDIRRGSVGTMETTNEDSKEDEDSHVHGLRFNSGTVNDKTEDNNEDDDEEEILIKRSSNAVASSTEHFSVSPRSARSISVSSYTRSQLPLKHPNFSYPTTSATTAHAKFHKSEVIPDQLHREGSHHHNSSHKNDEDDDLLFVMSDMNLTN atg1_klumd Serine/threonine-protein kinase ATG1 Autophagy-related protein 1 KLMA_30321 ATG1 protein protein kluyveromyces marxianus dmku3-1042 Kluyveromyces marxianus DMKU3-1042 MSSESHGKAVAKAIRLPTENYTVEKEIGKGSFAIVYKGVSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFFIKKRRSLVMKHPLIKTVFDLYPPPSAEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLQDYSDPKTFHEMGFIGIYNLPVLKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGRPPFKASNHLELFQKIKKANDEVTVPSNCYIEPKIFKLIKGLLTFDPEARMGFNEFFNNEVVTEDLSRYEASYEPDLESKSKDVAESNMFVSEYLVRPAAQEKANGGLRTDEGSAMPGAEHTYNKEREHYRERQDLQGQQQQQQQHPDSPPRGSTQGYQSSAGQTRMKSSYNDLILEKEYVVVEKKTVEVNSLADDFANNGPTTNNQGAQIIKPLRYRTSSSSDGHGGRRASLVERRLSISSLSPSNALSKALGLASVRLFGYQQPNTQTTSTSTHPTLLNPQIFHELTENAVLRADHHLNLFNEQISDSNITPFVESLSAKAFVMYSFAEMKFSQILPSPPSSTDYYSQSDKRLSNGSCAIDDDDDLDSGNPSSNQTLTPGANKVSAANVDNLIPAPELKKLCMESLLLYLKSLTILASSMKLTSKWWYENESKNCTLKLNILVQWIRDRFNECLDKAEFLRLKLHTLNQSEDPQVLDDEPTIFVEKLIYDRALDISRNAARLEMEGGNYNTCELAYATSLWMLEILLDEHLSSNEVYDDGYSSNITSLDESDKEMIRKYVSSIANRLKALKSKMS atg13_yeast Autophagy-related protein 13 ATG13 APG13 YPR185W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAEEDIEKQVLQLIDSFFLKTTLLICSTESSRYQSSTENIFLFDDTWFEDHSELVSELPEIISKWSHYDGRKELPPLVVETYLDLRQLNSSHLVRLKDHEGHLWNVCKGTKKQEIVMERWLIELDNSSPTFKSYSEDETDVNELSKQLVLLFRYLLTLIQLLPTTELYQLLIKSYNGPQNEGSSNPITSTGPLVSIRTCVLDGSKPILSKGRIGLSKPIINTYSNALNESNLPAHLDQKKITPVWTKFGLLRVSVSYRRDWKFEINNTNDELFSARHASVSHNSQGPQNQPEQEGQSDQDIGKRQPQFQQQQQPQQQQQQQQQQQRQHQVQTQQQRQIPDRRSLSLSPCTRANSFEPQSWQKKVYPISRPVQPFKVGSIGSQSASRNPSNSSFFNQPPVHRPSMSSNYGPQMNIEGTSVGSTSKYSSSFGNIRRHSSVKTTENAEKVSKAVKSPLQPQESQEDLMDFVKLLEEKPDLTIKKTSGNNPPNINISDSLIRYQNLKPSNDLLSEDLSVSLSMDPNHTYHRGRSDSHSPLPSISPSMHYGSLNSRMSQGANASHLIARGGGNSSTSALNSRRNSLDKSSNKQGMSGLPPIFGGESTSYHHDNKIQKYNQLGVEEDDDDENDRLLNQMGNSATKFKSSISPRSIDSISSSFIKSRIPIRQPYHYSQPTTAPFQAQAKFHKPANKLIDNGNRSNSNNNNHNGNDAVGVMHNDEDDQDDDLVFFMSDMNLSKEG 45CD16F69B795E62 atg1_yeast Serine/threonine-protein kinase ATG1 ATG1 APG1 AUT3 YGL180W G1615 CVT10 Autophagy-related protein 1 Autophagy protein 3 Cytoplasm to vacuole targeting protein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGDIKNKDHTTSVNHNLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPAQRIGFEEFFANKVVNEDLSSYELEDDLPELESKSKGIVESNMFVSEYLSKQPKSPNSNLAGHQSMADNPAELSDALKNSNILTAPAVKTDHTQAVDKKASNNKYHNSLVSDRSFEREYVVVEKKSVEVNSLADEVAQAGFNPNPIKHPTSTQNQNVLLNEQFSPNNQQYFQNQGENPRLLRATSSSSGGSDGSRRPSLVDRRLSISSLNPSNALSRALGIASTRLFGGANQQQQQQQITSSPPYSQTLLNSQLFHELTENIILRIDHLQHPETLKLDNTNIVSILESLAAKAFVVYSYAEVKFSQIVPLSTTLKGMANFENRRSMDSNAIAEEQDSDDAEEEDETLKKYKEDCLSTKTFGKGRTLSATSQLSATFNKLPRSEMILLCNEAIVLYMKALSILSKSMQVTSNWWYESQEKSCSLRVNVLVQWLREKFNECLEKADFLRLKINDLRFKHASEVAENQTLEEKGSSEEPVYLEKLLYDRALEISKMAAHMELKGENLYNCELAYATSLWMLETSLDDDDFTNAYGDYPFKTNIHLKSNDVEDKEKYHSVLDENDRIIIRKYIDSIANRLKILRQKMNHQN 7F4C785AA3A7CC46 atg17_yeast Autophagy-related protein 17 ATG17 APG17 YLR423C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNEADVTKFVNNARKTLTDAQLLCSSANLRIVDIKKKLSSWQLSISKLNFLIVGLRQQGKFLYTILKEGIGTKLIQKQWNQAVLVVLVDEMKYWQYEITSKVQRLDGIVNELSISEKDDTDPSKLGDYISRDNVNLLNDKLKEVPVIERQIENIKLQYENMVRKVNKELIDTKLTDVTQKFQSKFGIDNLMETNVAEQFSRELTDLEKDLAEIMNSLTQHFDKTLLLQDKKIDNDEREELFKVVQGDDKELYNIFKTLHEVIDDVDKTILNLGQFLQAKIKEKTELHSEVSEIINDFNRNLEYLLIFKDISNLIDSFKNSCTQDIQTTKELCEFYDNFEESYGNLVLEAKRRKDVANRMKTILKDCEKQLQNLDAQDQEERQNFIAENGTYLPETIWPGKIDDFSSLYTLNYNVKNP 71504B6C76549B75 ulk1_mouse Serine/threonine-protein kinase ULK1 Ulk1 Unc-51-like kinase 1 Serine/threonine-protein kinase Unc51.1 protein protein mouse Mus musculus Mouse MEPGRGGVETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSEDTVRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPGGRRANPSNIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPAIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASTPIKKSPPVPVPSYPSSGSGSSSSSSSASHLASPPSLGEMPQLQKTLTSPADAAGFLQGSRDSGGSSKDSCDTDDFVMVPAQFPGDLVAEAASAKPPPDSLLCSGSSLVASAGLESHGRTPSPSPTCSSSPSPSGRPGPFSSNRYGASVPIPVPTQVHNYQRIEQNLQSPTQQQTARSSAIRRSGSTTPLGFGRASPSPPSHTDGAMLARKLSLGGGRPYTPSPQVGTIPERPSWSRVPSPQGADVRVGRSPRPGSSVPEHSPRTTGLGCRLHSAPNLSDFHVVRPKLPKPPTDPLGATFSPPQTSAPQPCPGLQSCRPLRGSPKLPDFLQRSPLPPILGSPTKAGPSFDFPKTPSSQNLLTLLARQGVVMTPPRNRTLPDLSEASPFHGQQLGSGLRPAEDTRGPFGRSFSTSRITDLLLKAAFGTQASDSGSTDSLQEKPMEIAPSAGFGGTLHPGARGGGASSPAPVVFTVGSPPSGATPPQSTRTRMFSVGSSSSLGSTGSSSARHLVPGACGEAPELSAPGHCCSLADPLAANLEGAVTFEAPDLPEETLMEQEHTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWGFAEQLVLYLKVAELLSSGLQTAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDGIHGVTAERLILSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHTLTDQADIENIAKCKLCIERRLSALLSGVYA mint homomint Involved in axon growth. Plays an essential role in neurite extension of cerebellar granule cells atg13_human Autophagy-related protein 13 ATG13 KIAA0652 protein protein human Homo sapiens Human METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ c5db94_lactc Autophagy-related protein 13 KLTH0A00704g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MTTSLDKQLWELIDNFFLKAALLICHSKGWKGAPAADEGPPTTNSWFNIETFGDTKLERELKPWTTFDGSESLPPLVIETYLDLARLSPSQQVTLKDQDGNPWNVCKGTKKSEIMLERWLIQLDNGEDSPSLQSSGSEDTDDNVSELYRQLVLLFRYLETLVGLLPASELQARLIRPGVSPEAPPPVKLGTRILDGSKPIVSKGRIGLSKSLIATYSNVINETNLPAHLEQRKITPIRTKFGSLRISVSYRKDCDFHVNGSEEYNTQFNQETRSRSAAPVATPSLRRVSMNSNRSMSISPNTTISPSPLAEPSPQKRGTVLARQLQPFKAGSVGSGSLPQVQQGSLSRNPSATSVAAALRAQRPSNGSITAPTSQLHESHLEPSSIGSGSLSKYSSSFGRLRRQSSVRRSDSVERSQKPSKLNESPSGDLLDFMKLLDDRKELKLKNKGTKVDISNSLLKFQGMRTTNNNLSTDLSMSMSLERPSVSQPRNRSNSHSPNSSFSPSIQYSSIPMRLSQSRSDSYRPEILGELSSARGSTERPKSIISNLNESFYDGRRLGGRTSSNEGYAEDEEDEEDEEDLLVGRSAMNPASTNFRNRSTSPGSVRSVSSSFSKSQLPFKSLSNFSGPTTMATPAHAKLHKAIVGNSPETNVSDALPKKDDSLNQEEDDDLLFFMSDMNLSK c5deb9_lactc-c5df24_lactc-1 3265759 N/A 3265775 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3265776 unspecified role unspecified role unspecified role unspecified role Region 1-86 Region 1-86 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265777 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false atg1-atg13-2 3265760 N/A 3265778 unspecified role unspecified role unspecified role unspecified role Region 441-500 Region 441-500 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265779 unspecified role unspecified role unspecified role unspecified role Region 566-836 Region 566-836 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false scatg13-scatg1-1 3265761 N/A 3265780 unspecified role unspecified role bait bait Region 460-491 Region 460-491 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q06628:p.[Phe468Ala;Leu472Ala] F468A/L472A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 460-521 Region 460-521 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265781 unspecified role unspecified role prey prey Region 587-897 Region 587-897 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false scatg1-scatg13-1 3265762 N/A 3265780 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3265781 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false scatg13-scatg17-1 3265763 N/A 3265782 unspecified role unspecified role prey prey Q06410:p.[Asp247Ala;Glu250Ala] D247A/E250A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q06410:p.Asp247Ala D247A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q06410:p.[Leu240Ala;Val243Ala] L240A/V243A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q06410:p.[Ile213Ala;Ser216Ala] I213A/S216A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265780 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 424-436 Region 424-436 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false atg1-atg13-3 3265764 N/A 3265778 unspecified role unspecified role unspecified role unspecified role Region 441-500 Region 441-500 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265779 unspecified role unspecified role unspecified role unspecified role Region 566-836 Region 566-836 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false scatg13-scatg17-2 3265765 N/A 3265782 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3265780 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q06628:p.Ser429Asp S429D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false scatg1-scatg13-2 3265766 N/A 3265780 unspecified role unspecified role unspecified role unspecified role Region 460-491 Region 460-491 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q06628:p.[Phe468Ala;Leu472Ala] F468A/L472A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q06628:p.Phe468Ala F468A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265781 unspecified role unspecified role unspecified role unspecified role Region 587-897 Region 587-897 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false atg1-atg13-4 3265767 N/A 3265778 unspecified role unspecified role prey prey Region 441-500 Region 441-500 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265779 unspecified role unspecified role bait bait Region 566-836 Region 566-836 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false atg13-ulk1-1 3265768 N/A 3265783 unspecified role unspecified role prey prey Region 834-1051 Region 834-1051 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265784 unspecified role unspecified role bait bait Region 458-517 Region 458-517 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false scatg13-scatg17-3 3265769 N/A 3265782 unspecified role unspecified role prey prey Q06410:p.Asp247Ala D247A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3265780 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false scatg1-scatg13-3 3265770 N/A 3265780 unspecified role unspecified role prey prey Region 460-491 Region 460-491 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q06628:p.[Phe468Ala;Leu472Ala] F468A/L472A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q06628:p.Phe468Ala F468A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q06628:p.Leu472Ala L472A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3265781 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Deletion of region 492-521 decreased the interaction rate/strength. scatg13-scatg17-4 3265771 N/A 3265782 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3265780 unspecified role unspecified role bait bait Region 424-436 Region 424-436 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q06628:p.[Ser428Ala;Ser429Ala] S428A/S429A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q06628:p.[Phe430Ala;Ile433Ala] F430A/I433A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q06628:p.[Arg434Ala;Arg435Ala] R434A/R435A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q06628:p.Ser429Asp S429D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false c5db94_lactc-c5deb9_lactc-1 3265772 N/A 3265785 unspecified role unspecified role unspecified role unspecified role Region 392-404 Region 392-404 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3265775 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3265776 unspecified role unspecified role unspecified role unspecified role Region 1-86 Region 1-86 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265777 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false c5df24_lactc-c5deb9_lactc-1 3265773 N/A 3265775 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3265776 unspecified role unspecified role prey prey Region 1-86 Region 1-86 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265777 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false scatg13-scatg17-5 3265774 N/A 3265782 unspecified role unspecified role unspecified role unspecified role Q06410:p.Asp247Ala D247A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q06410:p.[Asp247Ala;Glu250Ala] D247A/E250A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3265780 unspecified role unspecified role unspecified role unspecified role Region 424-436 Region 424-436 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false