DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ marcoux-2014-1 ecolx Escherichia coli ion mobility mass spec ion mobility mass spectrometry of complexes ion mobility mass spec predetermined predetermined participant predetermined Marcoux J., Politis A., Rinehart D., Marshall DP., Wallace MI., Tamm LK., Robinson CV. DIP original experiment: DIP-260653X Structure (London, England : 1993) 2014 IMEx Mass spectrometry defines the C-terminal dimerization domain and enables modeling of the structure of full-length OmpA. Marcoux J., Politis A., Rinehart D., Marshall DP., Wallace MI., Tamm LK., Robinson CV. Only protein-protein interactions imex curation marcoux-2014-2 ecolx Escherichia coli crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Marcoux J., Politis A., Rinehart D., Marshall DP., Wallace MI., Tamm LK., Robinson CV. DIP original experiment: DIP-260654X Structure (London, England : 1993) 2014 IMEx Mass spectrometry defines the C-terminal dimerization domain and enables modeling of the structure of full-length OmpA. Marcoux J., Politis A., Rinehart D., Marshall DP., Wallace MI., Tamm LK., Robinson CV. Only protein-protein interactions imex curation ompa_ecoli Outer membrane protein A ompA tolG tut con Outer membrane protein II* b0957 JW0940 Outer membrane porin A Outer membrane protein 3A Outer membrane protein B Outer membrane protein d protein protein ecoli Escherichia coli (strain K12) MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA ompa-1 3265511 N/A 3265513 unspecified role unspecified role unspecified role unspecified role Region 209-297 Region 209-297 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P0A910:p.Lys213Ala K213A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ompa-7 3265512 N/A 3265513 unspecified role unspecified role unspecified role unspecified role Region 22-297 Region 22-297 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false