DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ anafi-2014-1 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260705X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-2 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260694X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-3 human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260736X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-4 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260728X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-5 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260717X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-6 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260727X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-7 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260695X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-8 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260715X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-9 human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260737X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-10 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260696X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-11 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260706X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-12 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260716X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-13 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260726X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-14 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260734X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-15 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260719X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-16 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260730X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-17 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260708X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-18 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260707X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-19 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260697X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-20 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260720X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-21 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260735X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-22 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260729X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-23 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260709X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-24 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260718X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-25 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260698X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-26 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260722X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-27 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260699X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-28 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260740X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-29 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260700X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-30 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260710X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-31 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260712X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-32 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260731X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-33 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260701X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-34 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260711X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-35 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260721X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-36 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260702X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-37 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260738X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-38 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260713X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-39 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260733X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-40 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260725X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-41 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260723X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-42 human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260739X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-43 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260703X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-44 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260724X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-45 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260732X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-46 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260704X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation anafi-2014-47 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260714X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions imex curation per1_mouse Period circadian protein homolog 1 Per1 Per Rigui Circadian clock protein PERIOD 1 Circadian pacemaker protein Rigui protein protein mouse Mus musculus Mouse MSGPLEGADGGGDPRPGEPFCPGGVPSPGAPQHRPCPGPSLADDTDANSNGSSGNESNGPESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCAMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGVLLRCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLKDFTQEKSVFCRIRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAPSLDSDIQELSEQIHRLLLQPVHSSSPTGLCGVGPLMSPGPLHSPGSSSDSNGGDAEGPGPPAPVTFQQICKDVHLVKHQGQQLFIESRAKPPPRPRLLATGTFKAKVLPCQSPNPELEVAPVPDQASLALAPEEPERKETSGCSYQQINCLDSILRYLESCNIPSTTKRKCASSSSYTASSASDDDKQRAGPVPVGAKKDPSSAMLSGEGATPRKEPVVGGTLSPLALANKAESVVSVTSQCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPTPDAYRPVGLTKAVLSLHTQKEEQAFLNRFRDLGRLRGLDTSSVAPSAPGCHHGPIPPGRRHHCRSKAKRSRHHHHQTPRPETPCYVSHPSPVPSSGPWPPPPATTPFPAMVQPYPLPVFSPRGGPQPLPPAPTSVSPATFPSPLVTPMVALVLPNYLFPTPPSYPYGVSQAPVEGPPTPASHSPSPSLPPPPLSPPHRPDSPLFNSRCSSPLQLNLLQLEESPRTEGGAAAGGPGSSAGPLPPSEETAEPEARLVEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRSSQSSHTSKYFGSIDSSEAEAGAARARTEPGDQVIKCVLQDPIWLLMANADQRVMMTYQVPSRDAASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVTACVDCGSSVQDPGHSDDPLFSELDGLGLEPMEEGGGEGGGCGVGGGGGDGGEEAQTQIGAKGSSSQDSAMEEEEQGGGSSSPALPAEENSTS cry2_mouse Cryptochrome-2 Cry2 Kiaa0658 protein protein mouse Mus musculus Mouse MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQAGSISNTGPRALSSGPASPKRKLEAAEEPPGEELTKRARVTEMPTQEPASKDS clock_human Circadian locomoter output cycles protein kaput CLOCK KIAA0334 BHLHE8 Class E basic helix-loop-helix protein 8 protein protein human Homo sapiens Human MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSFSSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDPSKVQPQ bmal2_mouse Aryl hydrocarbon receptor nuclear translocator-like protein 2 Arntl2 Bmal2 Brain and muscle ARNT-like 2 protein protein mouse Mus musculus Mouse MEFPRKRRGRDSQPLQSEFMTDTTVESLPQNPFASLLSTRTGVSAPSGIREAHSQMEKRRRDKMNHLIQKLSSMIPPHIPTAHKLDKLSVLRRAVQYLRSLRGMTELYLGENSKPSFIQDKELSHLILKAAEGFLFVVGCERGRIFYVSKSVSKTLRYDQASLIGQNLFDFLHPKDVAKVKEQLSCDGSPREKPIDTKTSQVYSHPYTGRPRMHSGSRRSFFFRMKSCTVPVKEEQPCSSCSKKKDHRKFHTVHCTGYLRSWPLNVVGMEKESGGGKDSGPLTCLVAMGRLHPYIVPQKSGKINVRPAEFITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRVKDGAFVTLKSEWFSFTNPWTKELEYIVSVNTLVLGRSETRLSLLHCGGSSQSSEDSFRQSCINVPGVSTGTVLGAGSIGTDIANEVLSLQRLHSSSPEDASPSEEVRDDCSVNGGNAYGPASTREPFAVSPSETEVLEAARQHQSTEPAHPHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWAL ciart_human Circadian-associated transcriptional repressor CIART C1orf51 ChIP-derived repressor of network oscillator Computationally highlighted repressor of the network oscillator protein protein human Homo sapiens Human MDSPSSVSSYSSYSLSSSFPTSPVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPGPIRCRHRSKVSGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQIAAQKSSLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFSHGPLGTGTGIGVILFLQHGVQPFTHSAPTTPVPPTTASPVIPGEPMKLSGEGPRCYSLPVTLPSDWSYTLSPPSLPTLARKMTIGHREQQRSHPPVAADAHLLNL bmal1_mouse Aryl hydrocarbon receptor nuclear translocator-like protein 1 Arntl Bmal1 Brain and muscle ARNT-like 1 Arnt3 protein protein mouse Mus musculus Mouse MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKDRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL ifm1_mouse Interferon-induced transmembrane protein 1 Ifitm1 Dispanin subfamily A member 2a Fragilis protein 2 Mouse ifitm-like protein 2 protein protein mouse Mus musculus Mouse MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSVKSRDRKMVGDTTGAQAFASTAKCLNISSLFFTILTAIVVIVVCAIR cry1_mouse Cryptochrome-1 Cry1 protein protein mouse Mus musculus Mouse MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGENVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKVQRQSSN per2_mouse Period circadian protein homolog 2 Per2 Circadian clock protein PERIOD 2 protein protein mouse Mus musculus Mouse MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDNGKELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYSMEQVEGITSEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSYTTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAPPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGQEESHRRRSGIFKTSGKIQTKSHVSHESGGQKEASVAEMQSSPPAQVKAVTTIERDSSGASLPKASFPEELAYKNQPPCSYQQISCLDSVIRYLESCSEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESVVSLTSQCSYSSTIVHVGDKKPQPELETVEDMASGPESLDGAAGGLSQEKGPLQKLGLTKEVLAAHTQKEEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGLESSWKKTGKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLMGLNATAWSPSDTSQSSCPSAPFPTAVPAYPLPVFQAPGIVSTPGTVVAPPAATHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAFMLPSYPFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSTLRQPCACPVTPPAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGTSRDRQPKAPPTCNEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLGSSSLGFGTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMIPDTEESEQFIKYVLQDPIWLLMANTDDSIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGGLPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTGPRIEAQT cbs_mouse Cystathionine beta-synthase Cbs Serine sulfhydrase Beta-thionase protein protein mouse Mus musculus Mouse MPSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT mint npas2_human Neuronal PAS domain-containing protein 2 NPAS2 BHLHE9 MOP4 PASD4 Basic-helix-loop-helix-PAS protein MOP4 Class E basic helix-loop-helix protein 9 Member of PAS protein 4 PAS domain-containing protein 4 protein protein human Homo sapiens Human MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPKEFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKEMCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCHQHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSHTAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLLPQTVLQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDSNVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLLRESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAALPPSLNLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQDSLLLSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR clock_mouse Circadian locomoter output cycles protein kaput Clock protein protein mouse Mus musculus Mouse MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTSVSTSTHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMTQRRSSFSSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNIQQLTPVNMQGQVVPANQVQSGHISTGQHMIQQQTLQSTSTQQSQQSVMSGHSQQTSLPSQTPSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQQQQQQQPPQQQQQQQQSSQEQQLPSVQQPAQAQLGQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQHQPQQQQQLPRHRTDSLTDPSKVQPQ nr1d1_human Nuclear receptor subfamily 1 group D member 1 NR1D1 EAR1 HREV THRAL Rev-erbA-alpha V-erbA-related protein 1 protein protein human Homo sapiens Human MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQAPSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ per3_mouse Period circadian protein homolog 3 Per3 Circadian clock protein PERIOD 3 protein protein mouse Mus musculus Mouse MDPCGDPAVPGGDCPQTRGPGLQGASGQEGPLQGTCVDSSHSEHEDRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSDFFQSLGPRGAHQADVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNNWTQRASQYECAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPVHASASSGYGSLGSSGSQEQHVSITSSSESSGHCPEEGQHEQMTLQQVYASVNKIKNVGQQLYIESMARSSVKPVAETCVEPQGGDEQKDFSSSQTLKNKSTTDTGSGGNLQQEQPSSSYQQMNCIDSVIRYLTSYSLPALKRKCISCTNTSSSSEEAKPIPEVDSSQRDTEQLLDIRKQETTGPSTDIEGGAARTLSTAALSVASGISQCSCSSTSGHAPPLQSESVAVACKPWALRTKASHLAAGGFKHVGLTAAVLSAHTQKEEQNYVDRFREKILTSPYGCYLQQESRNRAQYSCVQAGSTAKHSRCAGSERQKHKRKKLPAPVDTSSPGAHLCPHVTGLLPDEQHWGPSASPSPLGAGLAFPSALVVPSQTPYLLPSFPLQDMASQGVGVSAAWGAAAGCPPLSAGPQAVAAFPSAYVDTLMTIFLHNAPLFPLWPPSFSPYPSLGAAGSSELAPLVPAMAPNPEPTTSGHSQRRVEENWEAHSEELPFISSRSSSPLQLNLLQEEMPAPSESADAVRRGAGPDAKHHCVTGPSGSRSRHCTSGELATATAQQESAAASGSSASSIYFSSTDYASEVSENRQRPQDRQRDEALPGAAEESIWRMIERTPECVLMTYQVPERGREEVLKQDLEKLQSMEQQQPLFSPAQREELAKVRSWIHSHTAPQEGHLQSCVACEDRGSVGDTAEVLEQHPAEDTS bmal1_human Aryl hydrocarbon receptor nuclear translocator-like protein 1 ARNTL BMAL1 MOP3 Brain and muscle ARNT-like 1 Member of PAS protein 3 Basic-helix-loop-helix-PAS protein MOP3 bHLH-PAS protein JAP3 BHLHE5 PASD3 PAS domain-containing protein 3 Class E basic helix-loop-helix protein 5 protein protein human Homo sapiens Human MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL cbp_human CREB-binding protein CREBBP CBP Histone lysine acetyltransferase CREBBP Protein-lysine acetyltransferase CREBBP protein protein human Homo sapiens Human MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQPPNMMGAHTNNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSNGTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAGFPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNSMPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVISMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL cbp_mouse Histone lysine acetyltransferase CREBBP Crebbp Cbp Protein-lysine acetyltransferase CREBBP protein protein mouse Mus musculus Mouse MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQSMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPASGAQPPVIPPAQSVRPPNGPLPLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMGTHANNIMAQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAALPNPLNMLAPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQTPTPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGTPLSQAAASIDNRVPTPSSVTSAETSSQQPGPDVPMLEMKTEVQTDDAEPEPTESKGEPRSEMMEEDLQGSSQVKEETDTTEQKSEPMEVEEKKPEVKVEAKEEEENSSNDTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQNTALIAPHQIQGRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSPAGFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANINNGMPPGRAGMGTPGSQMTPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRPVMSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQPAMGGLNPQGQALNIMNPGHNPNMTNMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQNSASLAGGMAGHSQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL cry2-per1-2 3264989 N/A 3265036 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265037 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arntl2-clock-3 3264990 N/A 3265038 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265039 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arntl-ciart-2 3264991 N/A 3265040 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3265041 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false cry1-ifitm1-1 3264992 N/A 3265042 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265043 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false per2-per2-2 3264993 N/A 3265044 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265044 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false cry1-cbs-1 3264994 N/A 3265045 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265043 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arntl2-npas2-3 3264995 N/A 3265046 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265039 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false per2-ciart-2 3264996 N/A 3265040 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265044 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arntl-clock-12 3264997 N/A 3265047 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3265041 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false arntl-ciart-3 3264998 N/A 3265040 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265041 unspecified role unspecified role bait bait Region 78-626 Region 78-626 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false cry2-arntl-4 3264999 N/A 3265041 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265037 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false per2-per1-1 3265000 N/A 3265036 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265044 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false ciart-arntl-3 3265001 N/A 3265040 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265041 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false ciart-per1-1 3265002 N/A 3265036 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3265040 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false per2-cry2-3 3265003 N/A 3265037 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265044 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false per2-nr1d1-1 3265004 N/A 3265048 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3265044 unspecified role unspecified role bait bait Venus-tag Venus-tag venus venus fluorescent protein tag venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false cry1-per2-7 3265005 N/A 3265044 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265043 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false cry1-per1-1 3265006 N/A 3265043 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265036 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false arntl-clock-13 3265007 N/A 3265038 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265041 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false per2-clock-1 3265008 N/A 3265044 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265038 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false ciart-per3-1 3265009 N/A 3265049 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3265040 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false per2-ciart-3 3265010 N/A 3265040 unspecified role unspecified role prey prey S-tag S-tag s tag s tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3265048 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3265044 unspecified role unspecified role bait bait Venus-tag Venus-tag venus venus fluorescent protein tag venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false cry1-per3-1 3265011 N/A 3265049 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265043 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false per2-cry1-1 3265012 N/A 3265043 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265044 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false npas2-arntl2-3 3265013 N/A 3265046 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265039 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false per1-per2-3 3265014 N/A 3265036 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265044 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false npas2-arntl-3 3265015 N/A 3265041 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265046 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false crebbp-arntl-1 3265016 N/A 3265050 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265051 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false clock-arntl-9 3265017 N/A 3265038 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265041 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false cry1-arntl-6 3265018 N/A 3265041 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265043 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false cry1-npas2-1 3265019 N/A 3265046 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265043 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false ciart-arntl-4 3265020 N/A 3265038 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3265040 unspecified role unspecified role bait bait S-tag S-tag s tag s tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3265041 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false clock-arntl2-1 3265021 N/A 3265038 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265039 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false cry1-clock-1 3265022 N/A 3265038 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265043 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false per1-per1-1 3265023 N/A 3265036 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265036 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false clock-clock-1 3265024 N/A 3265038 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265038 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false ciart-arntl-5 3265025 N/A 3265040 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3265041 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false per3-per1-1 3265026 N/A 3265036 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265049 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false ciart-per2-2 3265027 N/A 3265040 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3265044 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ciart-per2-3 3265028 N/A 3265040 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265044 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false per1-cry1-1 3265029 N/A 3265043 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265036 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arntl-crebbp-1 3265030 N/A 3265052 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3265041 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false clock-per2-4 3265031 N/A 3265044 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265038 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false per1-cry2-1 3265032 N/A 3265036 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265037 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false ciart-arntl-6 3265033 N/A 3265040 unspecified role unspecified role bait bait S-tag S-tag s tag s tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3265041 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false cry2-per2-1 3265034 N/A 3265037 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3265044 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false per3-per2-1 3265035 N/A 3265044 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3265049 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false