DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2014-35 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. DIP original experiment: DIP-260649X Structure (London, England : 1993) 2014 IMEx Structural determinants for the strict monomethylation activity by trypanosoma brucei protein arginine methyltransferase 7. Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. Only protein-protein interactions imex curation wang-2014-36 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. DIP original experiment: DIP-260651X Structure (London, England : 1993) 2014 IMEx Structural determinants for the strict monomethylation activity by trypanosoma brucei protein arginine methyltransferase 7. Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. Only protein-protein interactions imex curation wang-2014-37 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. DIP original experiment: DIP-260644X Structure (London, England : 1993) 2014 IMEx Structural determinants for the strict monomethylation activity by trypanosoma brucei protein arginine methyltransferase 7. Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. Only protein-protein interactions imex curation wang-2014-38 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. DIP original experiment: DIP-260647X Structure (London, England : 1993) 2014 IMEx Structural determinants for the strict monomethylation activity by trypanosoma brucei protein arginine methyltransferase 7. Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. Only protein-protein interactions imex curation wang-2014-39 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. DIP original experiment: DIP-260645X Structure (London, England : 1993) 2014 IMEx Structural determinants for the strict monomethylation activity by trypanosoma brucei protein arginine methyltransferase 7. Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. Only protein-protein interactions imex curation wang-2014-40 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. DIP original experiment: DIP-260652X Structure (London, England : 1993) 2014 IMEx Structural determinants for the strict monomethylation activity by trypanosoma brucei protein arginine methyltransferase 7. Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. Only protein-protein interactions imex curation wang-2014-41 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. DIP original experiment: DIP-260646X Structure (London, England : 1993) 2014 IMEx Structural determinants for the strict monomethylation activity by trypanosoma brucei protein arginine methyltransferase 7. Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. Only protein-protein interactions imex curation wang-2014-42 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. DIP original experiment: DIP-260648X Structure (London, England : 1993) 2014 IMEx Structural determinants for the strict monomethylation activity by trypanosoma brucei protein arginine methyltransferase 7. Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. Only protein-protein interactions imex curation wang-2014-43 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. DIP original experiment: DIP-260650X Structure (London, England : 1993) 2014 IMEx Structural determinants for the strict monomethylation activity by trypanosoma brucei protein arginine methyltransferase 7. Wang C., Zhu Y., Caceres TB., Liu L., Peng J., Wang J., Chen J., Chen X., Zhang Z., Zuo X., Gong Q., Teng M., Hevel JM., Wu J., Shi Y. Only protein-protein interactions imex curation q9xy40_9tryp RBP16 protein protein 9tryp Trypanosoma brucei MIRASIVKRMAPCTLFLNKGKVISWMSGRGFGFIEDDADKKQHFVHFSALQTETGGFRALTVGQEVEFEVASQDGRTRAENVTSPGGAKLPSGPRPPEGAGRGRGFGGGRGGRDFGGDRNSGRGRNDNQQGGQHQSFSDDF anm7_tryb2 Protein arginine N-methyltransferase 7 PRMT7 Tb927.7.5490 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MPPKQHRHQKKDKNDNALQNTIGFVPPGATLASVSGYRPPDAFVNRIDRNIPVPARLRHTPVSLIEAVNDFHYAMMNDEERNNFYYEVLKKHVTPETGVLEIGAGSGLLSLMAAKLGAKWVVAVEGSEELAKLARENIRANNMEHQVKVLHMMSTELKSKHLPEPPDVLLSEIFGTMMLGESALDYVVDVRNRLLKPTTKIIPQFGTQYAVPIECDALHRISSVSGWRDLDLKHMMTLQDTVSIVFAKHYGIRMNSVNFRRLSDPIELFRVDFSSSNRNDIPRRKHFDVVAKESGTAHAMLFYWKVTDDEFVMSTDPEDTVNNFPRDMQWGQALQLLDASNGPLPTPVVFTEGKNYNFECNFSGDRVILHMQLCPESGNGEMTECEGKTT 32C2C7EEF1EB45B1 anm1_human Protein arginine N-methyltransferase 1 PRMT1 Interferon receptor 1-bound protein 4 Histone-arginine N-methyltransferase PRMT1 HMT2 HRMT1L2 IR1B4 protein protein human Homo sapiens Human MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG anm5_caeel Protein arginine N-methyltransferase 5 prmt-5 tag-251 C34E10.5 protein protein caeel Caenorhabditis elegans MSNRTYADNLFPQQVAEQHEEQMSSGSSPKSNSPSRSISSVEAANSRIHIGWMATTLDVAENLDRHVATFCTRLGEFKYNFVVYPIGGVVRAFWTPNGSAENHPPVIDLPDVQLRNDLWESYVVGKISPWIDCDSSDPAFASLSEEHLLKELSYICYLGLQTMAIELTRISSPRTAAILKKWIWTRNSRFTVWVQLPSAIEKCKDYDAFTIEHVDLWTIWADFRKNCGNFSGVYFQVALTISSELPDELTELKLVDRWKAEPLAAFVIESGLFISGRNGEASIPSAHINLLKHLWTTDALRIVLRATTDTFKYNTSIKSEYSQALRHAVRNVNYRSRPDVGEGSNDSTHYLNVIEYKDVLQAPLQPLSENLDSGVYNTFEQDQIKYDVYGEAVVGALKDLGADGRKTVVIYLLGGGRGPIGTKILKSEREYNNTFRQGQESLKVKLYIVEKNPNAIVTLKYMNVRTWKRRVTIIESDMRSLPGIAKDRGFEQPDIIVSELLGSFGDNELSPECLDGVTGFLKPTTISIPQKYTSYVKPIMSTHIHQTIKAQSIPYLSRAIPSHGRGEPELDEDEMWIQKYPQGHVRNNMDQIYVVYLSKYIPLAETTKPVFTFEHPNFMNSSNERSDSIEFVMDRNADLMGFAGYFDLQLYKTVMLSIEPSTHTPGMVSWFPAVIPLRDQLRVGEGDRISLKIDRKVDNTGVWYEWHVEKKKTNGESVSTPIQNPNGESYYMRM rbp16-tbprmt7-1 3264820 N/A 3264829 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3264830 enzyme enzyme unspecified role unspecified role Region 36-378 Region 36-378 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli methylation methylation reaction methylation false false false hist1h4a-prmt1-2 3264821 N/A 3264831 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3264832 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 2-22 Region 2-22 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R4me2 R4me2 nnme2arg dimethylated L-arginine Dimethyl NNMe2Arg dimethylr western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli methylation methylation reaction methylation false false false tbprmt7-1 3264822 N/A 3264830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false hist1h4a-tbprmt7-1 3264823 N/A 3264832 unspecified role unspecified role unspecified role unspecified role Region 2-22 Region 2-22 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R4me1 R4me1 me1arg monomethylated L-arginine Me1Arg Methyl N-methyl Arginyl methylr certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3264830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tbprmt7-2 3264824 N/A 3264830 unspecified role unspecified role unspecified role unspecified role Region 36-378 Region 36-378 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hist1h4a-prmt_5-1 3264825 N/A 3264833 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3264832 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 2-22 Region 2-22 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R4me2 R4me2 nnme2arg dimethylated L-arginine Dimethyl NNMe2Arg dimethylr western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain false R4me1 R4me1 me1arg monomethylated L-arginine Me1Arg Methyl N-methyl Arginyl methylr western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli methylation methylation reaction methylation false false false hist1h4a-tbprmt7-2 3264826 N/A 3264832 unspecified role unspecified role unspecified role unspecified role Region 2-22 Region 2-22 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3264830 unspecified role unspecified role unspecified role unspecified role Region 36-378 Region 36-378 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hist1h4a-tbprmt7-3 3264827 N/A 3264832 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 2-22 Region 2-22 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R4me1 R4me1 me1arg monomethylated L-arginine Me1Arg Methyl N-methyl Arginyl methylr certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3264830 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli methylation methylation reaction methylation false false false hist1h4a-tbprmt7-4 3264828 N/A 3264832 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 2-22 Region 2-22 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R4me1 R4me1 me1arg monomethylated L-arginine Me1Arg Methyl N-methyl Arginyl methylr western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3264830 enzyme enzyme unspecified role unspecified role Region 36-378 Region 36-378 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q582G4:p.Gln329Ser Q329S mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli methylation methylation reaction methylation false false false