DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mathavan-2014-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mathavan I., Zirah S., Mehmood S., Choudhury HG., Goulard C., Li Y., Robinson CV., Rebuffat S., Beis K. DIP original experiment: DIP-260978X Nature chemical biology 2014 IMEx Structural basis for hijacking siderophore receptors by antimicrobial lasso peptides. Mathavan I., Zirah S., Mehmood S., Choudhury HG., Goulard C., Li Y., Robinson CV., Rebuffat S., Beis K. Only protein-protein interactions imex curation mathavan-2014-2 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Mathavan I., Zirah S., Mehmood S., Choudhury HG., Goulard C., Li Y., Robinson CV., Rebuffat S., Beis K. DIP original experiment: DIP-260979X Nature chemical biology 2014 IMEx Structural basis for hijacking siderophore receptors by antimicrobial lasso peptides. Mathavan I., Zirah S., Mehmood S., Choudhury HG., Goulard C., Li Y., Robinson CV., Rebuffat S., Beis K. Only protein-protein interactions imex curation fhua_ecoli Ferrichrome outer membrane transporter/phage receptor JW0146 fhuA tonA b0150 Ferric hydroxamate uptake Ferric hydroxamate receptor Ferrichrome-iron receptor protein protein ecoli Escherichia coli (strain K12) MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLNLYNPVNTDFDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF mcja_ecolx Microcin J25 mcjA Class II lasso peptide Ribosomally synthesized and post-translationally modified peptide protein protein ecolx Escherichia coli MIKHFHFNKLSSGKKNNVPSPAKGVIQIKKSASQLTKGGAGHVPEYFVGIGTPISFYG fhua-mcja-1 3264632 N/A 3264634 unspecified role unspecified role unspecified role unspecified role Region 53-747 Region 53-747 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3264635 unspecified role unspecified role unspecified role unspecified role Region 38-58 Region 38-58 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fhua-mcja-2 3264633 N/A 3264634 unspecified role unspecified role unspecified role unspecified role Region 53-747 Region 53-747 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3264635 unspecified role unspecified role unspecified role unspecified role Region 38-58 Region 38-58 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9X2V7:p.His42Lys H42K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false