DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ satoh-2014-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Satoh T., Saeki Y., Hiromoto T., Wang YH., Uekusa Y., Yagi H., Yoshihara H., Yagi-Utsumi M., Mizushima T., Tanaka K., Kato K. DIP original experiment: DIP-260638X Structure (London, England : 1993) 2014 IMEx Structural basis for proteasome formation controlled by an assembly chaperone nas2. Satoh T., Saeki Y., Hiromoto T., Wang YH., Uekusa Y., Yagi H., Yoshihara H., Yagi-Utsumi M., Mizushima T., Tanaka K., Kato K. Only protein-protein interactions imex curation satoh-2014-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Satoh T., Saeki Y., Hiromoto T., Wang YH., Uekusa Y., Yagi H., Yoshihara H., Yagi-Utsumi M., Mizushima T., Tanaka K., Kato K. DIP original experiment: DIP-260637X Structure (London, England : 1993) 2014 IMEx Structural basis for proteasome formation controlled by an assembly chaperone nas2. Satoh T., Saeki Y., Hiromoto T., Wang YH., Uekusa Y., Yagi H., Yoshihara H., Yagi-Utsumi M., Mizushima T., Tanaka K., Kato K. Only protein-protein interactions imex curation satoh-2014-3 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Satoh T., Saeki Y., Hiromoto T., Wang YH., Uekusa Y., Yagi H., Yoshihara H., Yagi-Utsumi M., Mizushima T., Tanaka K., Kato K. DIP original experiment: DIP-260640X Structure (London, England : 1993) 2014 IMEx Structural basis for proteasome formation controlled by an assembly chaperone nas2. Satoh T., Saeki Y., Hiromoto T., Wang YH., Uekusa Y., Yagi H., Yoshihara H., Yagi-Utsumi M., Mizushima T., Tanaka K., Kato K. Only protein-protein interactions imex curation satoh-2014-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Satoh T., Saeki Y., Hiromoto T., Wang YH., Uekusa Y., Yagi H., Yoshihara H., Yagi-Utsumi M., Mizushima T., Tanaka K., Kato K. DIP original experiment: DIP-260639X Structure (London, England : 1993) 2014 IMEx Structural basis for proteasome formation controlled by an assembly chaperone nas2. Satoh T., Saeki Y., Hiromoto T., Wang YH., Uekusa Y., Yagi H., Yoshihara H., Yagi-Utsumi M., Mizushima T., Tanaka K., Kato K. Only protein-protein interactions imex curation prs6a_yeast 26S proteasome regulatory subunit 6A RPT5 YTA1 YOR117W O3258 YOR3258W Tat-binding protein homolog 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA C215422033FCE830 prs10_yeast 26S proteasome subunit RPT4 RPT4 CRL13 PCS1 SUG2 26S protease subunit SUG2 Proteasomal cap subunit YOR259C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEEQDPLLAGLGETSGDNHTQQSHEQQPEQPQETEEHHEEEPSRVDPEQEAHNKALNQFKRKLLEHRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQKL 0EA42A599E2B2E2A prs4_yeast 26S proteasome regulatory subunit 4 homolog RPT2 YHS4 YTA5 YDL007W D2920 Tat-binding homolog 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGQGVSSGQDKKKKKGSNQKPKYEPPVQSKFGRKKRKGGPATAEKLPNIYPSTRCKLKLLRMERIKDHLLLEEEFVSNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL EB735354C3A0EBD4 psmd9_yeast Probable 26S proteasome regulatory subunit p27 NAS2 YIL007C Proteasome non-ATPase subunit 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEEEELSKLLANVKIDPSLTSRISQIDSFKLSELMVLKTDIETQLEAYFSVLEQQGIGMDSALVTPDGYPRSDVDVLQVTMIRKNVNMLKNDLNHLLQRSHVLLNQHFDNMNVKSNQDARRNNDDQAIQYTIPFAFISEVVPGSPSDKADIKVDDKLISIGNVHAANHSKLQNIQMVVMKNEDRPLPVLLLREGQILKTSLTPSRNWNGRGLLGCRIQEL 1BA966C5B7B2D02B prs8_yeast 26S proteasome regulatory subunit 8 homolog TBPY TBY1 YGL048C RPT6 CIM3 CRL3 SUG1 Protein SUG1 Protein CIM3 Tat-binding protein TBY1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK 9C59E92A0794F60F prs6b_yeast 26S proteasome regulatory subunit 6B homolog RPT3 YNT1 YTA2 YDR394W D9509.14 Protein YNT1 Tat-binding homolog 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEELGIVTPVEKAVEEKPAVKSYASLLAQLNGTVNNNSALSNVNSDIYFKLKKLEKEYELLTLQEDYIKDEQRHLKRELKRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK E12F0995A60732BD nas2-rpt2-1 3264260 N/A 3264264 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264265 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264266 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264267 unspecified role unspecified role bait bait Region 1-120 Region 1-120 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false nas2-rpt2-2 3264261 N/A 3264268 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264264 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264265 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264266 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264267 unspecified role unspecified role bait bait Region 1-120 Region 1-120 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false nas2-rpt5-3 3264262 N/A 3264264 unspecified role unspecified role unspecified role unspecified role Region 428-434 Region 428-434 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3264267 unspecified role unspecified role unspecified role unspecified role Region 121-220 Region 121-220 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false nas2-rpt5-4 3264263 N/A 3264264 unspecified role unspecified role prey prey in vitro In vitro N/A 3264267 unspecified role unspecified role bait bait Region 1-120 Region 1-120 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false