DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ losn-2014-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. DIP original experiment: DIP-259683X Structure (London, England : 1993) 2014 IMEx The mitochondrial fission receptor MiD51 requires ADP as a cofactor. Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. Only protein-protein interactions imex curation losn-2014-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. DIP original experiment: DIP-259685X Structure (London, England : 1993) 2014 IMEx The mitochondrial fission receptor MiD51 requires ADP as a cofactor. Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. Only protein-protein interactions imex curation losn-2014-3 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. DIP original experiment: DIP-259689X Structure (London, England : 1993) 2014 IMEx The mitochondrial fission receptor MiD51 requires ADP as a cofactor. Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. Only protein-protein interactions imex curation losn-2014-4 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. DIP original experiment: DIP-259692X Structure (London, England : 1993) 2014 IMEx The mitochondrial fission receptor MiD51 requires ADP as a cofactor. Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. Only protein-protein interactions imex curation losn-2014-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. DIP original experiment: DIP-259684X Structure (London, England : 1993) 2014 IMEx The mitochondrial fission receptor MiD51 requires ADP as a cofactor. Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. Only protein-protein interactions imex curation losn-2014-6 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. DIP original experiment: DIP-259687X Structure (London, England : 1993) 2014 IMEx The mitochondrial fission receptor MiD51 requires ADP as a cofactor. Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. Only protein-protein interactions imex curation losn-2014-7 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. DIP original experiment: DIP-259690X Structure (London, England : 1993) 2014 IMEx The mitochondrial fission receptor MiD51 requires ADP as a cofactor. Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. Only protein-protein interactions imex curation losn-2014-8 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. DIP original experiment: DIP-259688X Structure (London, England : 1993) 2014 IMEx The mitochondrial fission receptor MiD51 requires ADP as a cofactor. Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. Only protein-protein interactions imex curation losn-2014-9 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. DIP original experiment: DIP-259691X Structure (London, England : 1993) 2014 IMEx The mitochondrial fission receptor MiD51 requires ADP as a cofactor. Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. Only protein-protein interactions imex curation losn-2014-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. DIP original experiment: DIP-259686X Structure (London, England : 1993) 2014 IMEx The mitochondrial fission receptor MiD51 requires ADP as a cofactor. Losón OC., Liu R., Rome ME., Meng S., Kaiser JT., Shan SO., Chan DC. Only protein-protein interactions imex curation mid51_mouse Mitochondrial dynamics protein MID51 Mief1 Mid51 Smcr7l Mitochondrial dynamics protein of 51 kDa homolog Mitochondrial elongation factor 1 Smith-Magenis syndrome chromosomal region candidate gene 7 protein-like protein protein mouse Mus musculus Mouse MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLNKDMKAGLSRSLQTLPTDSSAFDTDTFCPPRPKPLARRGQVDLKKSRLRMSLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT q8k1m6-3 Dynamin-1-like protein Dnm1l Drp1 Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 protein protein mouse Mus musculus Mouse MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKVPSAGGGIGDGGQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW mid49_mouse Mitochondrial dynamics protein MID49 Mief2 Gm11 Mid49 Smcr7 Mitochondrial dynamics protein of 49 kDa homolog Mitochondrial elongation factor 2 Smith-Magenis syndrome chromosomal region candidate gene 7 protein homolog protein protein mouse Mus musculus Mouse MAEFSQKQRKQSGSEGLGSVVDFLLANARLVLGVGGAAVLGIATLAVKRLIDRATSPPDEDDTKGDSWKELSLLRATSPQKPQPPPAAFSQPLATGSPSPSVPVEPTPIHSPTTPKFSTIAPLCLTFQERLLAFERKHVITPEAHVTLAKQLAGDIALELQAYLRSKFPELPFGALVPGGPLYDGLQAGTAEHVRLLAPLELEPGLWSLVPGVDTVAREPRCWAVRRTQLEFHPRGCSPWDRFLVGGYLSSRVLLELLRKALSASVNWPAIGSLLGCLIWPDVASEELLLKVQHECLEFTLAVLMVVPGASTDDRLLLAWPLEGLASNLWLQDLYPVETARLRALDDQDAGTRRRLLLLLCGICRGHPALVRLGWSHLTQVVLHLGEEEVAWTEEALGERFLQALEFLVGSLEQASLPCHFNPSVNLLGNFREEEIDDIGYVLYSGLQVPESLF mief1-1 3262827 N/A 3262837 unspecified role unspecified role unspecified role unspecified role Region 134-463 Region 134-463 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mief1-dnm1l-1 3262828 N/A 3262838 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3262837 unspecified role unspecified role bait bait Q8BGV8:p.[Arg234Ala;Arg235Ala;Asn237Ala] R234A/R235A/N237A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q8BGV8:p.[Glu239Ala;Tyr240Ala;Arg243Ala] E239A/Y240A/R243A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q8BGV8:p.[Val253Glu;Gly254Glu;Gly255Glu] V253E/G254E/G255E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false dnm1l-1 3262829 N/A 3262838 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dnm1l-mief2-1 3262830 N/A 3262839 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3262838 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mief1-mief1-1 3262831 N/A 3262837 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3262837 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q8BGV8:p.Arg169Ala R169A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q8BGV8:p.[Arg182Ala;Asp183Ala] R182A/D183A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q8BGV8:p.Arg182Ala R182A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q8BGV8:p.[Arg169Ala;Arg182Ala;Asp183Ala;Gln212Ala;Asn213Ala] R169A/R182A/D183A/Q212A/N213A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false dnm1l-mief1-1 3262832 N/A 3262838 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3262837 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dnm1l-mief1-2 3262833 N/A 3262838 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3262837 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dnm1l-mief2-2 3262834 N/A 3262839 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3262838 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dnm1l-mief1-3 3262835 N/A 3262838 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3262837 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mief1-dnm1l-2 3262836 N/A 3262838 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3262837 unspecified role unspecified role bait bait Q8BGV8:p.[Arg234Ala;Arg235Ala;Asn237Ala] R234A/R235A/N237A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q8BGV8:p.[Glu239Ala;Tyr240Ala;Arg243Ala] E239A/Y240A/R243A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false