DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ charng-2014-1 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259774X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-2 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259778X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-3 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259782X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-4 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259788X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-5 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259784X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-6 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259775X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-7 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259779X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-8 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259787X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-9 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259785X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-10 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259776X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-11 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259786X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-12 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259780X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-13 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259783X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-14 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259777X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation charng-2014-15 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. DIP original experiment: DIP-259781X PLoS biology 2014 IMEx Drosophila Tempura, a novel protein prenyltransferase α subunit, regulates notch signaling via Rab1 and Rab11. Charng WL., Yamamoto S., Jaiswal M., Bayat V., Xiong B., Zhang K., Sandoval H., David G., Gibbs S., Lu HC., Chen K., Giagtzoglou N., Bellen HJ. Only protein-protein interactions imex curation q9xz68_drome Geranylgeranyl transferase type-2 subunit beta RabGGTb Dmel\CG18627 GGT-II beta RabGGTbeta beta-ggt-II betaggt betaggt II betaggt-II CG18627 Dmel_CG18627 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDFTTFVKPSNGGGDSGGGGDADGGGQKLQFWKHVEYIENHGKQEDDYEYCMTEFLRMSGIYWGTTALDIMGQLERLERKSIIEFVKRCQCPNTGGFAPCEGHDPHLLYTLSAIQILCTYDALEEIDREAVVRFVVGLQQPDGSFFGDKWGEVDTRFSFCAVASLTLLGRMEQTIDVEKAVKFVLSCCNQTDGGFGSKPGAESHAGLIYCCVGFFSLTHRLHLLDVDKLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLTIMGRLHWISSEKLQQFILSCQDTETGGFSDRTGNMPDIFHTLFGIGGLSLLGHSGLKAINPTLCMPQYIIDRLGIKPQLLPRP q9w501_drome temp l(1)G0144 Dmel_CG3073 CG3073 Dmel\CG3073 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEEERNEKKVLCEKIIRDINAVFLKDQDLASFEIIPKEANCNKSPVVHVEHNLGLESWCAQHVYDHAHRTLISHRRQTTAQQLRTLQQQQQSDSLAKYLNVALLINPDVTTFWHIRRQLVQKNRLSINKELQFSALVLSIKPKSNEAFAYRRWLYSFQSADAIDWPNEIGICERAADRCASNYHAWSHRQWILQNGPCLLQSELLRTEKFMRKHISDYSCYHYRQVLLSRAYELSFALPKDSGASGSSTLASLQHLMTSYGLECEANAEDLLGLLLPHVDLSSVSKQRLISFLYCCNVAANDMRLCAEQRLMYGSRDCFELHRRAALKFIVEQCVRLQMGLPNGQLLPVASGDLRSHLGNFDFEDNPFLSAVRREESTLGGKHRRWCNLHLSFGYPAD rabep_drome Rab proteins geranylgeranyltransferase component A Rep CG8432 Rab escort protein homolog protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLDDLPEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFSMDALCARLDQEVEPHSALRNARYTWHSMEKESETDAQSWNRDSVLAKSRRFSLDLCPRILYAAGELVQLLIKSNICRYAEFRAVDHVCMRHNGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFLTACNDYGEDKCNEDSLEFRGRTFLEYLQAQRVTEKISSCVMQAIAMCGPSTSFEEGMQRTQRFLGSLGRYGNTPFLFPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFLLSSAGKTLRAKNVVSAPGYTPVSKGIELKPHISRGLFISSSPLGNEELNKGGGGVNLLRLLDNEGGREAFLIQLSHYTGACPEGLYIFHLTTPALSEDPASDLAIFTSQLFDQSDAQIIFSSYFTIAAQSSKSPAAEHIYYTDPPTYELDYDAAIANARDIFGKMFPDADFLPRAPDPEEIVVDGEDPSALNEHTLPEDLRAQLHDMQQATQEMDIQE o18332_drome Rab1 Rab1-RA CG3320 AAF55873 DRAB1 DRab1 Dm Rab1 DmRab1 Dmel\CG3320 O18332 RAB1a Rab1a dRab1 dar6 drab1 rab1 Dmel_CG3320 Dar6 omt protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGRPVENTKSGCC q9vn77_drome Geranylgeranyl transferase type-2 subunit alpha RabGGTa Dmel\CG12007 Geranylgeranyl transferase type II subunit alpha PTAR3 RabGGTalpha CG12007 Dmel_CG12007 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHGRVKVRTTEEERERKKKEQALKVRAYRAAMGRIQKKREAGELDNEMLSLTVQILLRNPDVSMLWNIRRECVLEKLFRLKEEEATCETPSEEKPEKENQTGENKPSEKKAAGEDKAHSIFTCELDLTEQCLMVNPKSYNAWHHRCWTLEQNPRADWQQEVKLCNKYLKFDERNFHTWDYRRYVTGKAMVPATQELDFCTEKIRANFSNYSSWHHRSLLLPELYPNQQRDRPMSEEKLQKELEMVLTAAFTDPNDSSAWFYQRWLLGSGAQLDRAPRIAAFRLESHGAVLALDKPYPDIKQLKTELVGGGQTILLEFWLPVDKRGTSWKCQQNFDYQRNSAYSLRLSDQKVDLSPLSGSENGAYYIAPPHGTTSCSKDLLAELQTQLQSCLDLLEFEPDSKWTLLTSALLMRAIDFSANHETSLAHLAKLEKVDFLREGYYKDLAARWTLEWELAKWPQSADFPKRFDIANAVLLESLPYDQYLVIADEITLPNKLRDKLGESVPKTFADLKLQS o18335_drome Rab11 Drab11 CG5771 AAF55850 DRAB11 DRab11 Dm Rab11 DmRab11 Dmel\CG5771 O18335 RAB11 Rab 11 Rab-11 Rab-r11 dRab11 l(3)93Bi l(3)j2D1 rab-11 rab11 rlr7 Dmel_CG5771 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPIDVKPTVTADVRKQCCQ temp-betaggt_ii-3 3262709 N/A 3262724 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false betaggt_ii-temp-3 3262710 N/A 3262724 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false temp-rab1-1 3262711 N/A 3262726 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262727 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false q9vn77_drome-betaggt_ii-3 3262712 N/A 3262728 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262724 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262726 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false temp-betaggt_ii-4 3262713 N/A 3262729 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262724 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false q9vn77_drome-betaggt_ii-4 3262714 N/A 3262728 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262724 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false betaggt_ii-q9vn77_drome-3 3262715 N/A 3262728 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262724 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false temp-betaggt_ii-5 3262716 N/A 3262724 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262726 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false temp-rab11-1 3262717 N/A 3262729 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262726 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false temp-rep-1 3262718 N/A 3262726 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false temp-betaggt_ii-6 3262719 N/A 3262729 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262724 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262726 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false temp-rab1-2 3262720 N/A 3262727 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false temp-betaggt_ii-7 3262721 N/A 3262724 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262726 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262727 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false q9vn77_drome-rep-1 3262722 N/A 3262726 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262728 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false temp-betaggt_ii-8 3262723 N/A 3262724 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262727 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262725 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false