DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ worden-2014-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Worden EJ., Padovani C., Martin A. DIP original experiment: DIP-260055X Nature structural & molecular biology 2014 IMEx Structure of the Rpn11-Rpn8 dimer reveals mechanisms of substrate deubiquitination during proteasomal degradation. Worden EJ., Padovani C., Martin A. Only protein-protein interactions imex curation worden-2014-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Worden EJ., Padovani C., Martin A. DIP original experiment: DIP-260056X Nature structural & molecular biology 2014 IMEx Structure of the Rpn11-Rpn8 dimer reveals mechanisms of substrate deubiquitination during proteasomal degradation. Worden EJ., Padovani C., Martin A. Only protein-protein interactions imex curation rpn11_yeast Ubiquitin carboxyl-terminal hydrolase RPN11 YFR004W RPN11 MPR1 Protein MPR1 26S proteasome regulatory subunit RPN11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK 9DDE8BD74890894D rpn8_yeast 26S proteasome regulatory subunit RPN8 RPN8 O5360 YOR261C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKDKQSKVSDDSESESGDKEATAPLIQRKNKKN 6EE6009545A3D0EF rpn11-rpn8-11 3262644 N/A 3262646 unspecified role unspecified role unspecified role unspecified role Region 2-239 Region 2-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3262647 unspecified role unspecified role unspecified role unspecified role Region 1-179 Region 1-179 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rpn11-rpn8-12 3262645 N/A 3262646 unspecified role unspecified role unspecified role unspecified role Region 2-239 Region 2-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3262647 unspecified role unspecified role unspecified role unspecified role Region 1-179 Region 1-179 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false