DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhang-2014-6 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265029X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-7 drome Drosophila melanogaster (Fruit fly) Fruit fly tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265025X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-8 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265037X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-9 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265033X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-10 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265030X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-11 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265026X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-12 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265041X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-13 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265038X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-14 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265034X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-15 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265031X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-16 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265027X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-17 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265039X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-18 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265035X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-19 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265032X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-20 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265028X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-21 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265040X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation zhang-2014-22 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Shalaby NA., Buszczak M. DIP original experiment: DIP-265036X Science (New York, N.Y.) 2014 IMEx Changes in rRNA transcription influence proliferation and cell fate within a stem cell lineage. Zhang Q., Shalaby NA., Buszczak M. Only protein-protein interactions imex curation q9w2g5_drome TAF1C-like Dmel\CG10496 Dmel_CG10496 TAF1Clike CG10496 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPRRYQTALNSAKYSAQVKTKTSDNESDSEDDLPPDQDAEDNNEPDNLRSILENAPHFSYPGLNTGMLGQLLYDHQDNPKQDLPNCSVTVPLPLFLAKDGQTPRVEACVQRPFRYDDWTRQLQLGKAIFDRRLKNMRQRVQKQEQGVHDASLFEMAEHIAQQENSFFRDSYDYYYTGGNLNTIPFDGNDQLAMHVSGNKLRDLHFSRDYGEAEFWQPLHSATIEESSSEVFELLPLHNLNRSQMFLARLLKEVSLYELKCKDEQDSDSDYELIRHCMFSSQVAPFTSAAQSLANANTLALASQDRSLRFVDISTQQDIAKLDVCLLKGLKKTSSTWAQLKQAEESTFHCLTQPVLFTVDVRCNLPLNPCFASGVHSKACERFSCLAKGVNPNLLYVASNHNFHCLDIRCLGKKLTDRAVVTWTHQMTYPPCFIDTSVHQDSEYIALGGLLPKDLRICELQGAQAKSVDEMFSPAIPFAPVTLEEALIDARLGGFVDVYADIAERVTTCITGMRFIGLEGASDQAFTQLLTSNSLGDVYCQRLTLRDEEEHVQQIRTGTHTTEAIRYLANAVNERVQRENIRCTQVQSIPEIRDIFRDGAKRSKPEEKPLIVEEIEIDYGIEDTDVSEDESPASEKVKEEPSESKKGGKKTPKKKTKVKPKRQPKRKAASKRNVKKQKSISRGPWQKSAYKLSHYTDMMSTRLLDVWDMEEYDTTRDVTREMFDERIKGKELEPEQRMANWLEQLPSQTVVPTEDEVTEGNPDMVPGTSLPKLYGATTANYSVIPALNSDQDIGERLLSPKKESPVEFGREYSILLPGQNTIIEDYPCAPPAKRPKVKHVKGF a1z7a5_drome Dmel\CG18316 Udd CG18316 Dmel_CG18316 udd protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKTKDEKPSPLKTAPRKIKGENFPARRIPANVLKRTLEIATSPEDGFWVNQNPSCAPPASNEFYFSVRRSTAYEKLRLARDCLMQRDYKNLAKILASNHMGETLLQRASFQIFTEYSKVLQKCPKFYTKMEQLRVEPTPPTRPTDEDIALDDSLNAILS taf1b_drome TATA box-binding protein-associated factor RNA polymerase I subunit B TAF1B TATA box-binding protein-associated factor 1B CG6241 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEEVLETMQLENMHCDVCEGTTFQEREGFYYCVECGTQKDQIRAVDITAEDNFDDTAAGRYTARTIRQKKDTEKEDEDDITSWEFYNYVLRGFLQELLNMGAKPELKLMTLQVWAAYLDSMEVAFSKSNKTGLPKLNVRALPIDARIIYNHKTFKKGKKGKKSTLTGDPNDERAKFRLWNRTKRNLDASGYRSHGGASESEGEQSLHLQWSMRARKSLKRHMPLKHLDKHSRDSKGSMSCHSLRPRVKQLHNFDRNIYCLNIIKLYVVLGIALNMVEDDIQLSDLLRFIDEEHLTKRCMLNYLPGNVAAKGKALLKDMELSKMKDKVTNKLLRVNIACMSRFINLSEYQKPNLHSLAERYILELALPPRLLKYVNSLLDLHPPTFFNAMTVHPYPRYEARTMAYILYAMKLLFGLDDLKERNISESAAKINEKLLEVGGDEAPLLFVFTEWMEFVEMRKVIVSHYNQSFARRFGVSTRTGCQVDDILAKEWKEKEQGETFGWMQGSAAMKRQHENLTHIIETMLKDHFGESSKESMEKEHIEFQPSLTPAHSYFNRILLQVSRSDGAKMKITIPDHMKVDHSARNLDPFVLETTELSQYLSQHGLKLRVEELACQEDIQNVGIFRPLTIIRGDGREYRANTEIKTETWISELKRKEKRPDFRFTQPTGTYGARYLKRITMRDARRVQLEINNPFWDVTETPSFLLKLNDNEIPLDSLSSLQTFEEGTMDPLNIPLDLPRRNLEKILNPEGSDRASDQVASDINDEPPSPETLLLQVSNFDCWLLHGYMKRIRRHDKHELRQLFPCSFRWLLETCASTIGIVWEELYEELLIVEVMYHHSIRDWSNHRNYLCIQHNTQEKDIRTLARTYKELW rpa2_drome DNA-directed RNA polymerase I subunit RPA2 RpI135 RPA135 CG4033 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLEEMQQMKTIPVLTNSRPEFKQIPKKLSRHLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKISMKVESIWIAKPKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMDLGEVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLVQGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDVTDFILRERVMIHLDTYEDKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESWVSQVRRCLQKKLTSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIASRTGLGLMQNSGLVIMAENINRMRYMSHFRAIHRGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTCEISMRPDPKLVKAIPKHLIDMGMMPLSNRRYLGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMRPVWNLKWKRVEYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKKSSYFARHPHMPELIKHLDTDGLPHPGSKLSYGSPLYCYFDGEVATYKVVKMDEKEDCIVESIRQLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINARFKLNEI taf1c_like-udd-1 3262217 N/A 3262234 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false udd-taf1b-1 3262218 N/A 3262234 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262236 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false rpi135-udd-1 3262219 N/A 3262237 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false taf1c_like-udd-2 3262220 N/A 3262234 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false udd-taf1b-2 3262221 N/A 3262236 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false udd-taf1b-3 3262222 N/A 3262236 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false rpi135-taf1b-1 3262223 N/A 3262236 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262237 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false taf1b-rpi135-1 3262224 N/A 3262236 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262237 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false udd-rpi135-1 3262225 N/A 3262237 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false taf1b-udd-1 3262226 N/A 3262236 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false taf1b-udd-2 3262227 N/A 3262236 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false rpi135-taf1b-2 3262228 N/A 3262236 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262237 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false rpi135-udd-2 3262229 N/A 3262237 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false udd-taf1c_like-1 3262230 N/A 3262234 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false udd-taf1c_like-2 3262231 N/A 3262234 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false taf1b-rpi135-2 3262232 N/A 3262236 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262237 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false udd-rpi135-2 3262233 N/A 3262237 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3262235 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false