DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hodson-2014-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hodson C., Purkiss A., Miles JA., Walden H. DIP original experiment: DIP-259671X Structure (London, England : 1993) 2014 IMEx Structure of the human FANCL RING-Ube2T complex reveals determinants of cognate E3-E2 selection. Hodson C., Purkiss A., Miles JA., Walden H. Only protein-protein interactions imex curation hodson-2014-2 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Hodson C., Purkiss A., Miles JA., Walden H. DIP original experiment: DIP-259673X Structure (London, England : 1993) 2014 IMEx Structure of the human FANCL RING-Ube2T complex reveals determinants of cognate E3-E2 selection. Hodson C., Purkiss A., Miles JA., Walden H. Only protein-protein interactions imex curation hodson-2014-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hodson C., Purkiss A., Miles JA., Walden H. DIP original experiment: DIP-259672X Structure (London, England : 1993) 2014 IMEx Structure of the human FANCL RING-Ube2T complex reveals determinants of cognate E3-E2 selection. Hodson C., Purkiss A., Miles JA., Walden H. Only protein-protein interactions imex curation q9nw38-1 E3 ubiquitin-protein ligase FANCL Fanconi anemia group L protein Fanconi anemia-associated polypeptide of 43 kDa RING-type E3 ubiquitin transferase FANCL FANCL PHF9 protein protein human Homo sapiens Human MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGRKH ube2t_human Ubiquitin-conjugating enzyme E2 T UBE2T Ubiquitin-protein ligase T Ubiquitin carrier protein T HSPC150 Cell proliferation-inducing gene 50 protein PIG50 E2 ubiquitin-conjugating enzyme T protein protein human Homo sapiens Human MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV fancl-ube2t-1 3261777 N/A 3261780 unspecified role unspecified role unspecified role unspecified role Region 289-375 Region 289-375 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3261781 unspecified role unspecified role unspecified role unspecified role Region 1-153 Region 1-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9NPD8:p.Arg60Glu R60E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fancl-ube2t-2 3261778 N/A 3261780 unspecified role unspecified role unspecified role unspecified role Region 289-375 Region 289-375 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3261781 unspecified role unspecified role unspecified role unspecified role Region 1-153 Region 1-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fancl-ube2t-3 3261779 N/A 3261780 unspecified role unspecified role unspecified role unspecified role Region 289-375 Region 289-375 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9NW38-1:p.Ile309Ala I309A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9NW38-1:p.Tyr311Ala Y311A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9NW38-1:p.Trp341Ala W341A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3261781 unspecified role unspecified role unspecified role unspecified role Region 1-153 Region 1-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false