DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ thompson-2014-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Thompson NJ., Merdanovic M., Ehrmann M., van Duijn E., Heck AJ. DIP original experiment: DIP-259669X Structure (London, England : 1993) 2014 IMEx Substrate occupancy at the onset of oligomeric transitions of DegP. Thompson NJ., Merdanovic M., Ehrmann M., van Duijn E., Heck AJ. Only protein-protein interactions imex curation thompson-2014-2 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Thompson NJ., Merdanovic M., Ehrmann M., van Duijn E., Heck AJ. DIP original experiment: DIP-259670X Structure (London, England : 1993) 2014 IMEx Substrate occupancy at the onset of oligomeric transitions of DegP. Thompson NJ., Merdanovic M., Ehrmann M., van Duijn E., Heck AJ. Only protein-protein interactions imex curation degp_ecoli Periplasmic serine endoprotease DegP degP htrA ptd b0161 JW0157 Heat shock protein DegP Protease Do protein protein ecoli Escherichia coli (strain K12) MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ degp-14 3261770 N/A 3261772 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degp-15 3261771 N/A 3261772 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false