DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ suzuki-2014-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259620X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-2 human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259611X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-3 human Homo sapiens Human pull down pull down anti tag western anti tag western blot anti tag western Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259609X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259628X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259619X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259614X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-7 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259625X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259621X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259616X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259615X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-11 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259627X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-12 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259624X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259617X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-14 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259622X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-15 human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259610X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-16 human Homo sapiens Human pull down pull down anti tag western anti tag western blot anti tag western Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259612X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-17 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259623X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-18 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259629X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-19 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259626X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-20 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259613X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation suzuki-2014-21 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. DIP original experiment: DIP-259618X Structure (London, England : 1993) 2014 IMEx Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism. Suzuki H., Tabata K., Morita E., Kawasaki M., Kato R., Dobson RC., Yoshimori T., Wakatsuki S. Only protein-protein interactions imex curation mlp3c_human Microtubule-associated proteins 1A/1B light chain 3C MAP1LC3C Microtubule-associated protein 1 light chain 3 gamma MAP1A/MAP1B light chain 3 C MAP1 light chain 3-like protein 3 Autophagy-related protein LC3 C Autophagy-related ubiquitin-like modifier LC3 C protein protein human Homo sapiens Human MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLEDRPCNPL atg13_human Autophagy-related protein 13 ATG13 KIAA0652 protein protein human Homo sapiens Human METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ rbcc1_human RB1-inducible coiled-coil protein 1 RB1CC1 KIAA0203 RBICC FAK family kinase-interacting protein of 200 kDa protein protein human Homo sapiens Human MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQLALEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAEMKRSTELVLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRESCQSTVHQQDETTIDTKDGDLPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQTIAKLDNQNMKAIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQLMIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELLERVKIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKRLYEAEKSKRESFGKLFRKSFLRNRLFRGLDSWPPSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPLLCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLSEQKASVSQTSPQSASSPRMESTAGITTTTSPRTPPPLTVQDPLCPAVCPLEELSPDSIDAHTFDFETIPHPNIEQTIHQVSLDLDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDTNVCGKEDFGDHTSLNVQLERCRVVAQDSHFSIQTIKEDLCHFRTFVQKEQCDFSNSLKCTAVEIRNIIEKVKCSLEITLKEKHQKELLSLKNEYEGKLDGLIKETEENENKIKKLKGELVCLEEVLQNKDNEFALVKHEKEAVICLQNEKDQKLLEMENIMHSQNCEIKELKQSREIVLEDLKKLHVENDEKLQLLRAELQSLEQSHLKELEDTLQVRHIQEFEKVMTDHRVSLEELKKENQQIINQIQESHAEIIQEKEKQLQELKLKVSDLSDTRCKLEVELALKEAETDEIKILLEESRAQQKETLKSLLEQETENLRTEISKLNQKIQDNNENYQVGLAELRTLMTIEKDQCISELISRHEEESNILKAELNKVTSLHNQAFEIEKNLKEQIIELQSKLDSELSALERQKDEKITQQEEKYEAIIQNLEKDRQKLVSSQEQDREQLIQKLNCEKDEAIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV ulk1_human Serine/threonine-protein kinase ULK1 ULK1 KIAA0722 Unc-51-like kinase 1 Autophagy-related protein 1 homolog protein protein human Homo sapiens Human MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGSGSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSSCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSPPAHAEHGGVLARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSAPEHSPRTSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPGSTESLQEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPRTRMFSAGPTGSASSSARHLVPGPCSEAPAPELPAPGHGCSFADPITANLEGAVTFEAPDLPEETLMEQEHTEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQLVLYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDRIHSITAERLIFSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHMLSDQADIENVTKCKLCIERRLSALLTGICA atga1_human Autophagy-related protein 101 ATG101 C12orf44 PP894 protein protein human Homo sapiens Human MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL q9h492-1 Microtubule-associated proteins 1A/1B light chain 3A MAP1LC3A Autophagy-related protein LC3 A Autophagy-related ubiquitin-like modifier LC3 A MAP1 light chain 3-like protein 1 MAP1A/MAP1B light chain 3 A Microtubule-associated protein 1 light chain 3 alpha protein protein human Homo sapiens Human MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV gbrap_human Gamma-aminobutyric acid receptor-associated protein GABA(A) receptor-associated protein MM46 GABARAP FLC3B HT004 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL map1lc3c-atg13-1 3260355 N/A 3260376 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3260377 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false map1lc3c-atg101-1 3260356 N/A 3260376 unspecified role unspecified role bait bait One-Strep-tag One-Strep-tag one-strep-tag one-strep-tag twin-strep-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260378 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260379 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260380 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260377 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false map1lc3a-atg101-1 3260357 N/A 3260378 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260379 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260380 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260377 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260381 unspecified role unspecified role bait bait One-Strep-tag One-Strep-tag one-strep-tag one-strep-tag twin-strep-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false atg13-map1lc3b-1 3260358 N/A 3260382 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3260377 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 441-447 Region 441-447 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false atg13-map1lc3c-1 3260359 N/A 3260376 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3260377 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false atg101-atg13-4 3260360 N/A 3260380 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3260377 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false atg13-map1lc3b-2 3260361 N/A 3260382 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3260377 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 436-450 Region 436-450 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false map1lc3c-atg13-2 3260362 N/A 3260376 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3260377 unspecified role unspecified role prey prey Region 245-450 Region 245-450 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false gabarap-atg13-1 3260363 N/A 3260383 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3260377 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false atg13-gabarap-1 3260364 N/A 3260383 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3260377 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false atg13-map1lc3a-1 3260365 N/A 3260381 unspecified role unspecified role prey prey Q9H492-1:p.Lys49Ala K49A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9H492-1:p.Lys51Ala K51A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9H492-1:p.Leu53Ala L53A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3260377 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 441-447 Region 441-447 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false atg13-map1lc3a-2 3260366 N/A 3260381 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3260377 unspecified role unspecified role bait bait Region 436-450 Region 436-450 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false atg13-map1lc3a-3 3260367 N/A 3260381 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3260377 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false atg13-map1lc3c-2 3260368 N/A 3260376 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3260377 unspecified role unspecified role bait bait Region 436-450 Region 436-450 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false map1lc3b-atg101-1 3260369 N/A 3260382 unspecified role unspecified role bait bait One-Strep-tag One-Strep-tag one-strep-tag one-strep-tag twin-strep-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260378 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260379 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260380 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260377 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false atg13-map1lc3c-3 3260370 N/A 3260376 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3260377 unspecified role unspecified role bait bait One-Strep-tag One-Strep-tag one-strep-tag one-strep-tag twin-strep-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false map1lc3a-atg13-1 3260371 N/A 3260381 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3260377 unspecified role unspecified role prey prey Region 245-450 Region 245-450 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false atg13-map1lc3c-4 3260372 N/A 3260376 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3260377 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 441-447 Region 441-447 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false atg13-map1lc3a-4 3260373 N/A 3260381 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3260377 unspecified role unspecified role bait bait Region 441-447 Region 441-447 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O75143:p.Asp442Ala D442A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O75143:p.Asp443Ala D443A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O75143:p.Phe444Ala F444A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O75143:p.Val445Ala V445A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O75143:p.Met446Ala M446A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O75143:p.Ile447Ala I447A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false atg13-atg101-4 3260374 N/A 3260380 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3260377 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false map1lc3a-atg13-2 3260375 N/A 3260381 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3260377 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false