DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ vostrikov-2013-1 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Vostrikov VV., Mote KR., Verardi R., Veglia G. DIP original experiment: DIP-255888X Structure (London, England : 1993) 2013 IMEx Structural dynamics and topology of phosphorylated phospholamban homopentamer reveal its role in the regulation of calcium transport. Vostrikov VV., Mote KR., Verardi R., Veglia G. Only protein-protein interactions imex curation vostrikov-2013-2 ecolx Escherichia coli solution nmr solution state nmr solution state nmr solution nmr predetermined predetermined participant predetermined Vostrikov VV., Mote KR., Verardi R., Veglia G. DIP original experiment: DIP-255889X Structure (London, England : 1993) 2013 IMEx Structural dynamics and topology of phosphorylated phospholamban homopentamer reveal its role in the regulation of calcium transport. Vostrikov VV., Mote KR., Verardi R., Veglia G. Only protein-protein interactions imex curation vostrikov-2013-3 ecolx Escherichia coli solid state nmr solid state nmr ssnmr solid state nmr predetermined predetermined participant predetermined Vostrikov VV., Mote KR., Verardi R., Veglia G. DIP original experiment: DIP-255890X Structure (London, England : 1993) 2013 IMEx Structural dynamics and topology of phosphorylated phospholamban homopentamer reveal its role in the regulation of calcium transport. Vostrikov VV., Mote KR., Verardi R., Veglia G. Only protein-protein interactions imex curation vostrikov-2013-4 in vitro In vitro solid state nmr solid state nmr ssnmr solid state nmr predetermined predetermined participant predetermined Vostrikov VV., Mote KR., Verardi R., Veglia G. DIP original experiment: DIP-255891X Structure (London, England : 1993) 2013 IMEx Structural dynamics and topology of phosphorylated phospholamban homopentamer reveal its role in the regulation of calcium transport. Vostrikov VV., Mote KR., Verardi R., Veglia G. Only protein-protein interactions imex curation ppla_rabit Cardiac phospholamban PLN protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL pln-5 3259960 N/A 3259964 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pln-7 3259961 N/A 3259964 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pln-8 3259962 N/A 3259964 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pln-9 3259963 N/A 3259964 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false