IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hermann-2013-2 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hermann C., Strittmatter LM., Deane JE., Boyle LH. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. lhb22@cam.ac.uk Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Only protein-protein interactions hermann-2013-1 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Hermann C., Strittmatter LM., Deane JE., Boyle LH. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. lhb22@cam.ac.uk Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Only protein-protein interactions hermann-2013-3 human-721.221 721.221 HLA-A, B, C-null phenotype lymphoblastoid cell line Human 721.221 721.221 HLA-A, B, C-null phenotype lymphoblastoid cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hermann C., Strittmatter LM., Deane JE., Boyle LH. lhb22@cam.ac.uk Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Only protein-protein interactions tpsnr_human Tapasin-related protein TAPBPL TAP-binding protein-like TAP-binding protein-related protein Tapasin-like protein protein human Homo sapiens Human MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVDVVLDCFLAKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVTCEISRYFLQMTETTVKTAAWFMANMQVSGGGPSISLVMKTPRVTKNEALWHPTLNLPLSPQGTVRTAVEFQVMTQTQSLSFLLGSSASLDCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLTLPGLTIQDEGTYICQITTSLYRAQQIIQLNIQASPKVRLSLANEALLPTLICDIAGYYPLDVVVTWTREELGGSPAQVSGASFSSLRQSVAGTYSISSSLTAEPGSAGATYTCQVTHISLEEPLGASTQVVPPERRTALGVIFASSLFLLALMFLGLQRRQAPTGLGLLQAERWETTSCADTQSSHLHEDRTARVSQPS 1a02_human HLA class I histocompatibility antigen, A-2 alpha chain HLA-A HLAA Human leukocyte antigen A*02 protein protein human Homo sapiens Human MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRKGGSYSQAASSDSAQGSDVSLTACKV Deprecated HLA-A AC, merged into a different UniProt canonical but we have mutation features in variable positions. Allele =A*02:01:01:01 Allele =A*02:01:01:01 according to IPD-IMGT/HLA database tpsn_human Tapasin TAP-binding protein TAP-associated protein NGS-17 TAPBP NGS17 TAPA protein protein human Homo sapiens Human MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE b2mg_human Beta-2-microglobulin B2M CDABP0092 HDCMA22P protein protein human Homo sapiens Human MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM tapbp-hla_a-1 2958583 N/A 2958586 unspecified role unspecified role prey prey N/A 2958587 unspecified role unspecified role bait bait p.Lys168Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false p.Asp146Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false p.Glu152Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false p.Trp157Thr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ala260glu variant variant certain certain sequence position certain certain certain sequence position certain false p.Thr158Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false p.[Glu246_Asp247delinsLysArg;Asp251Arg;Glu253Lys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false p.[Asp251Arg;Glu253Lys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3C, Supp 3 HLA-A*0209 allele (Ref 31) hla_a-tapbp-1 2958583 N/A 2958587 unspecified role unspecified role bait bait p.Thr158Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ala260glu variant variant certain certain sequence position certain certain certain sequence position certain false p.[Glu246_Asp247delinsLysArg;Asp251Arg;Glu253Lys] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false p.[Asp251Arg;Glu253Lys] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 2958588 unspecified role unspecified role prey prey physical association physical association false false false 3Ci HLA-A*0209 allele (Ref 31) 4w3tts-1 2958583 N/A 2958587 unspecified role unspecified role bait bait n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false p.Lys170Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ala260glu variant variant certain certain sequence position certain certain certain sequence position certain false N/A 2958586 unspecified role unspecified role prey prey N/A 2958588 unspecified role unspecified role prey prey association association false false false 3C HLA-A*0209 allele (Ref 31) tapbpl-hla_a-1 2958584 N/A 2958587 unspecified role unspecified role prey prey p.Ala260Glu mutation mutation certain certain sequence position certain certain certain sequence position certain false p.Thr158Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false p.Lys170Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false p.[Glu246_Asp247delinsLysArg;Asp251Arg;Glu253Lys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false p.[Asp251Arg;Glu253Lys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 2958586 unspecified role unspecified role bait bait physical association physical association false false false 3A HLA-A*0209 allele (Ref 31) tapbpl-hla_a-2 2958584 N/A 2958587 unspecified role unspecified role prey prey p.Ala260Glu mutation mutation certain certain sequence position certain certain certain sequence position certain false p.Thr158Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false p.Lys170Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false p.[Glu246_Asp247delinsLysArg;Asp251Arg;Glu253Lys] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false p.[Asp251Arg;Glu253Lys] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 2958588 unspecified role unspecified role bait bait physical association physical association false false false 3Ai HLA-A*0209 allele (Ref 31) tapbpl-hla_a-4 2958585 N/A 2958586 unspecified role unspecified role bait bait N/A 2958587 unspecified role unspecified role prey prey nucl infection nucleic acid delivery by infection nucl infection living cell living cell infection infection ala260glu variant variant certain certain sequence position certain certain certain sequence position certain false p.Thr158Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false p.[Asp251Arg;Glu253Lys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3D HLA-A*0209 allele (Ref 31) The cell line 721.221 does not express MHC class 1 molecules. tapbpl-hla_a-7 2958585 N/A 2958589 unspecified role unspecified role bait bait N/A 2958587 unspecified role unspecified role prey prey nucl infection nucleic acid delivery by infection nucl infection living cell living cell infection infection ala260glu variant variant certain certain sequence position certain certain certain sequence position certain false p.Thr158Lys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false p.[Asp251Arg;Glu253Lys] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3Di HLA-A*0209 allele (Ref 31) The cell line 721.221 does not express MHC class 1 molecules.