DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lapinaite-2013-1 in vitro In vitro sans small angle neutron scattering SANS SANS sans predetermined predetermined participant predetermined Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. DIP original experiment: DIP-256063X Nature 2013 IMEx The structure of the box C/D enzyme reveals regulation of RNA methylation. Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. Only protein-protein interactions imex curation lapinaite-2013-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. DIP original experiment: DIP-256061X Nature 2013 IMEx The structure of the box C/D enzyme reveals regulation of RNA methylation. Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. Only protein-protein interactions imex curation lapinaite-2013-3 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. DIP original experiment: DIP-256065X Nature 2013 IMEx The structure of the box C/D enzyme reveals regulation of RNA methylation. Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. Only protein-protein interactions imex curation lapinaite-2013-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. DIP original experiment: DIP-256066X Nature 2013 IMEx The structure of the box C/D enzyme reveals regulation of RNA methylation. Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. Only protein-protein interactions imex curation lapinaite-2013-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. DIP original experiment: DIP-256064X Nature 2013 IMEx The structure of the box C/D enzyme reveals regulation of RNA methylation. Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. Only protein-protein interactions imex curation lapinaite-2013-6 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. DIP original experiment: DIP-256062X Nature 2013 IMEx The structure of the box C/D enzyme reveals regulation of RNA methylation. Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. Only protein-protein interactions imex curation lapinaite-2013-7 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. DIP original experiment: DIP-256067X Nature 2013 IMEx The structure of the box C/D enzyme reveals regulation of RNA methylation. Lapinaite A., Simon B., Skjaerven L., Rakwalska-Bange M., Gabel F., Carlomagno T. Only protein-protein interactions imex curation fibrillarin-1 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase protein protein pyrfu Pyrococcus furiosus This sequence has been withdrawn from Uniprot. rl7a_pyrfu 50S ribosomal protein L7Ae Ribosomal protein L8e PF1367 rpl7ae Large ribosomal subunit protein eL8 protein protein pyrfu Pyrococcus furiosus MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK q8u4m1_pyrfu PF0060 protein protein pyrfu Pyrococcus furiosus MKAFISENVRGIYAFDENGNLIEKRYFTDKPEKVLDQLLKGEITKDLEELLNSLKEKGYDEFVFEHPELSRRAKELGFSATTEFPNIAGERLRSNPEEFLGENWFEEYYKVGVALTRMRIQEQSGARDKMVIQAIEALDDVDKVINLLVARLREWYSLHFPELDELLPKHPQYVAFVKTVGHRDNINEEVLRELGLSEEKIKKILEAKEKTMGAWMDQTDIEVVRQLAEEIDRLYQLRKKLEDYIDRAMDDVAPNLKALVGAKLAARLISLAGGLRELAMMPSSTIQVLGAEKALFRHLRTGAKPPKHGVIYQYPAINRSPWWQRGKIARALAGKLAIAARVDYFSGEYIAEELKKELEARIREIKEKYPKPPKRKREERKGKKPWKKDKKKKKKKEKPRRR fibrillarin-q8u4m1_pyrfu-1 3259393 N/A 3259400 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259401 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259402 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false fibrillarin-q8u4m1_pyrfu-2 3259394 N/A 3259400 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259401 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259402 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false fibrillarin-q8u4m1_pyrfu-3 3259395 N/A 3259400 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259402 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fibrillarin-q8u4m1_pyrfu-4 3259396 N/A 3259400 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259402 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fibrillarin-q8u4m1_pyrfu-5 3259397 N/A 3259400 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259401 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259402 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false fibrillarin-q8u4m1_pyrfu-6 3259398 N/A 3259400 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259401 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259402 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false fibrillarin-q8u4m1_pyrfu-7 3259399 N/A 3259400 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259401 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259402 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false