DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fong-2013-1 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256091X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256089X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-3 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256096X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256100X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256098X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-6 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256094X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256092X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256090X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-9 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256097X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-10 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256099X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-11 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256093X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation fong-2013-12 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. DIP original experiment: DIP-256095X PLoS biology 2013 IMEx Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease. Fong YH., Wong HC., Yuen MH., Lau PH., Chen YW., Wong KB. Only protein-protein interactions imex curation ureg_helpy Urease accessory protein UreG ureG HP_0068 protein protein helpy Helicobacter pylori Campylobacter pylori MVKIGVCGPVGSGKTALIEALTRHMSKDYDMAVITNDIYTKEDAEFMCKNSVMPRERIIGVETGGCPHTAIREDASMNLEAVEEMHGRFPNLELLLIESGGDNLSATFNPELADFTIFVIDVAEGDKIPRKGGPGITRSDLLVINKIDLAPYVGADLKVMERDSKKMRGEKPFIFTNIRAKEGLDDVIAWIKRNALLED Probably facilitates nickel incorporation mint ureh_helpy Urease accessory protein UreH HP_0067 ureH protein protein helpy Helicobacter pylori Campylobacter pylori MNTYAQESKLRLKTKIGADGRCVIEDNFFTPPFKLMAPFYPKDDLAEIMLLAVSPGMMRGDAQDVQLNIGPNCKLRITSQSFEKIHNTEDGFASRDMHIVVGENAFLDFAPFPLIPFENAHFKGNTTISLRSSSQLLYSEIIVAGRVARNELFKFNRLHTKISILQDEKPIYYDNTILDPKTTDLNNMCMFDGYTHYLNLVLVNCPIELSGVRECIEESEGVDGAVSETASSHLCVKALAKGSEPLLHLREKIARLVTQTTTQKV mint Probably facilitates nickel incorporation uref_helpy Urease accessory protein UreF HP_0069 ureF protein protein helpy Helicobacter pylori Campylobacter pylori MDKGKSVKSTEKSVGMPPKTPKTDNNAHVDNEFLILQVNDAVFPIGSYTHSFGLETYIQQKKVTNKESALEYLKANLSSQFLYTEMLSLKLTYESALQQDLKKILGVEEVIMLSTSPMELRLANQKLGNRFIKTLQAMNELDMGEFFNAYAQKTKDPTHATSYGVFAASLGIELKKALRHYLYAQTSNMVINCVKSVPLSQNDGQKILLSLQSPFNQLIEKTLELDESHLCTASVQNDIKAMQHESLYSRLYMS Probably facilitates nickel incorporation mint ure1_helpy Urease subunit beta ureB hpuB HP_0072 Urea amidohydrolase subunit beta protein protein helpy Helicobacter pylori Campylobacter pylori MKKISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEELDLIITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHFISPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLADQIEAGAIGFKIHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLDKSIKEDVQFADSRIRPQTIAAEDTLHDMGIFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYDANITFVSQAAYDKGIKEELGLERQVLPVKNCRNITKKDMQFNDTTAHIEVNPETYHVFVDGKEVTSKPANKVSLAQLFSIF mint Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach ure23_helpy Urease subunit alpha ureA hpuA HP_0073 Urea amidohydrolase subunit alpha protein protein helpy Helicobacter pylori Campylobacter pylori MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE mint Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach uref-ureg-1 3259245 N/A 3259257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259259 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false uref-ureg-2 3259246 N/A 3259257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259259 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false ureg-1 3259247 N/A 3259257 unspecified role unspecified role unspecified role unspecified role Q09066:p.Cys66Ala C66A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q09066:p.His68Ala H68A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false urea-ureb-13 3259248 N/A 3259260 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259261 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false uref-ureg-3 3259249 N/A 3259257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3259259 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q09065:p.[Arg179Ala;Tyr183Asp] R179A/Y183D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false uref-ureh-1 3259250 N/A 3259258 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3259259 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false uref-ureh-3 3259251 N/A 3259258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259259 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false uref-ureg-4 3259252 N/A 3259257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259259 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false uref-ureg-5 3259253 N/A 3259257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3259258 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3259259 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false uref-urea-1 3259254 N/A 3259260 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3259261 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3259257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3259258 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3259259 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false uref-ureh-4 3259255 N/A 3259258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3259259 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ureg-2 3259256 N/A 3259257 unspecified role unspecified role unspecified role unspecified role Q09066:p.Cys66Ala C66A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q09066:p.His68Ala H68A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false