DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ burmann-2013-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Burmann BM., Wang C., Hiller S. DIP original experiment: DIP-255668X Nature structural & molecular biology 2013 IMEx Conformation and dynamics of the periplasmic membrane-protein-chaperone complexes OmpX-Skp and tOmpA-Skp. Burmann BM., Wang C., Hiller S. Only protein-protein interactions imex curation burmann-2013-2 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Burmann BM., Wang C., Hiller S. DIP original experiment: DIP-255666X Nature structural & molecular biology 2013 IMEx Conformation and dynamics of the periplasmic membrane-protein-chaperone complexes OmpX-Skp and tOmpA-Skp. Burmann BM., Wang C., Hiller S. Only protein-protein interactions imex curation burmann-2013-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Burmann BM., Wang C., Hiller S. DIP original experiment: DIP-255670X Nature structural & molecular biology 2013 IMEx Conformation and dynamics of the periplasmic membrane-protein-chaperone complexes OmpX-Skp and tOmpA-Skp. Burmann BM., Wang C., Hiller S. Only protein-protein interactions imex curation burmann-2013-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Burmann BM., Wang C., Hiller S. DIP original experiment: DIP-255669X Nature structural & molecular biology 2013 IMEx Conformation and dynamics of the periplasmic membrane-protein-chaperone complexes OmpX-Skp and tOmpA-Skp. Burmann BM., Wang C., Hiller S. Only protein-protein interactions imex curation burmann-2013-5 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Burmann BM., Wang C., Hiller S. DIP original experiment: DIP-255667X Nature structural & molecular biology 2013 IMEx Conformation and dynamics of the periplasmic membrane-protein-chaperone complexes OmpX-Skp and tOmpA-Skp. Burmann BM., Wang C., Hiller S. Only protein-protein interactions imex curation ompa_ecoli Outer membrane protein A ompA tolG tut con Outer membrane protein II* b0957 JW0940 Outer membrane porin A Outer membrane protein 3A Outer membrane protein B Outer membrane protein d protein protein ecoli Escherichia coli (strain K12) MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA skp_ecoli Chaperone protein Skp skp ompH hlpA b0178 Seventeen kilodalton protein Histone-like protein HLP-1 DNA-binding 17 kDa protein JW0173 protein protein ecoli Escherichia coli (strain K12) MKKWLLAAGLGLALATSAQAADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK This sequence has been withdrawn from Uniprot. ompx_ecoli Outer membrane protein X ompX b0814 ybiG JW0799 protein protein ecoli Escherichia coli (strain K12) MKKIACLSALAAVLAFTAGTSVAATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF ompa-skp-5 3258978 N/A 3258983 unspecified role unspecified role unspecified role unspecified role Region 22-198 Region 22-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3258984 unspecified role unspecified role unspecified role unspecified role Region 21-161 Region 21-161 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ompx-skp-1 3258979 N/A 3258985 unspecified role unspecified role unspecified role unspecified role Region 24-171 Region 24-171 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3258984 unspecified role unspecified role unspecified role unspecified role Region 21-161 Region 21-161 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false skp-2 3258980 N/A 3258984 unspecified role unspecified role unspecified role unspecified role Region 21-161 Region 21-161 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ompx-skp-2 3258981 N/A 3258985 unspecified role unspecified role unspecified role unspecified role Region 24-171 Region 24-171 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3258984 unspecified role unspecified role unspecified role unspecified role Region 21-161 Region 21-161 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ompa-skp-6 3258982 N/A 3258983 unspecified role unspecified role unspecified role unspecified role Region 22-198 Region 22-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3258984 unspecified role unspecified role unspecified role unspecified role Region 21-161 Region 21-161 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false