DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pearson-2013-1 human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256033X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256015X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256020X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256028X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256021X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256024X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256016X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256032X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256029X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256025X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256017X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256022X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256018X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-14 in vitro In vitro glycosylase assay glycosylase assay predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256030X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-15 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256026X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-16 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256019X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-17 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256023X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-18 in vitro In vitro glycosylase assay glycosylase assay predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256031X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation pearson-2013-19 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256027X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions imex curation fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD p25445-1 Tumor necrosis factor receptor superfamily member 6 FAS APT1 FAS1 TNFRSF6 Apo-1 antigen Apoptosis-mediating surface antigen FAS FASLG receptor protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV tnfl6_human Tumor necrosis factor ligand superfamily member 6 Fas antigen ligand CD95L Apoptosis antigen ligand FASLG APT1LG1 FASL TNFSF6 CD95 ligand protein protein human Homo sapiens Human MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL nleb1_eco27 Protein-arginine N-acetylglucosaminyltransferase NleB1 nleB1 Non-LEE-encoded type III effector B1 nleB E2348C_3231 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MLSSLNVLQSSFRGKTALSNSTLLQKVSFAGKEYSLEPIDERTPILFQWFEARPERYEKGEVPILNTKEHPYLSNIINAAKIENERIIGVLVDGNFTYEQKKEFLNLENEHQNIKIIYRADVDFSMYDKKLSDIYLENIHKQESYPASERDNYLLGLLREELKNIPEGKDSLIESYAEKREHTWFDFFRNLAILKAGSLFTETGKTGCHNISPCSGCIYLDADMIITDKLGVLYAPDGIAVHVDCNDEIKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGLGKGIKRHFNYSSLHNYNAFCDFIEFKHENIIPNTSMYTSSSW ehecnleb1 Hypothetical protein Z4328 protein protein escherichia coli o157:h7 str. edl933 Escherichia coli O157:H7 str. EDL933 ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN tradd_human Tumor necrosis factor receptor type 1-associated DEATH domain protein TRADD TNFRSF1A-associated via death domain protein protein human Homo sapiens Human MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA nleb2_eco27 Protein-arginine N-acetylglucosaminyltransferase NleB2 nleB2 Non-LEE-encoded type III effector B2 E2348C_1041 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MLSPIRTTFHNSVNIVQSSPCQTVSFAGKEYELKVIDEKTPILFQWFEPNPERYKKDEVPIVNTKQHPYLDNVTNAARIESDRMIGIFVDGDFSVNQKTAFSKLERDFENVMIIYREDVDFSMYDRKLSDIYHDIICEQRLRTEDKRDEYLLNLLEKELREISKAQDSLISMYAKKRNHAWFDFFRNLALLKAGEIFRCTYNTKNHGISFGEGCIYLDMDMILTGKLGTIYAPDGISMHVDRRNDSVNIENSAIIVNRSNHPALLEGLSFMHSKVDAHPYYDGLGKGVKKYFNFTPLHNYNHFCDFIEFNHPNIIMNTSQYTCSSW d2tt37_citri nleB1 ROD_10831 protein protein Citrobacter freundii biotype 4280 Citrobacter rodentium (strain ICC168) Citrobacter freundii biotype 4280 MLSPLNVLQFNFRGETALSDSAPLQTVSFAGKDYSMEPIDEKTPILFQWFEARPERYGKGEVPILNTKEHPYLSNIINAAKIENERVIGVLVDGDFTYEQRKEFLSLEDEHQNIKIIYRENVDFSMYDKKLSDIYLENIHEQESYPASERDNYLLGLLREELKNIPYGKDSLIESYAEKRGHTWFDFFRNLAVLKGGGLFTETGKTGCHNISPCGGCIYLDADMIITDKLGVLYAPDGIAVYVDCNDNRKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGVGKGLKRHFNYSSLQDYNVFCNFIEFKHKNIIPNTSMYTNSSW faslg-casp8-1 3258249 N/A 3258268 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3258269 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3258270 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3258271 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false b7ui21_eco27-fadd-1 3258250 N/A 3258268 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258272 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ehecnleb1-ripk1-1 3258251 N/A 3258273 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258274 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false b7ui21_eco27-tradd-3 3258252 N/A 3258275 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3258272 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false b7ui21_eco27-fadd-2 3258253 N/A 3258268 unspecified role unspecified role prey prey Region 97-208 Region 97-208 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3258272 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false b7ui21_eco27-fadd-3 3258254 N/A 3258268 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3258272 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false b7ui21_eco27-fadd-4 3258255 N/A 3258268 unspecified role unspecified role prey prey Region 97-208 Region 97-208 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258272 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false b7unx3_eco27-ripk1-1 3258256 N/A 3258276 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3258274 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false b7ui21_eco27-ripk1-1 3258257 N/A 3258274 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3258272 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false b7ui21_eco27-tradd-4 3258258 N/A 3258275 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3258272 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false b7ui21_eco27-ripk1-2 3258259 N/A 3258274 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258272 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ehecnleb1-fadd-1 3258260 N/A 3258273 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false human Homo sapiens Human N/A 3258268 unspecified role unspecified role prey prey Region 97-208 Region 97-208 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false b7ui21_eco27-ripk1-3 3258261 N/A 3258274 unspecified role unspecified role prey prey Region 583-671 Region 583-671 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258272 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false b7ui21_eco27-fadd-5 3258262 N/A 3258268 enzyme target enzyme target substrate substrate unspecified role unspecified role R117-GlcNAc R117-GlcNAc omega-n-glucosyl-l-arginine omega-N-glucosyl-L-arginine (2S)-2-amino-5-(beta-D-glucopyranosyl[imino(methylamino)methyl]amino)pentanoic acid NG-beta-D-glucosylarginine omega-N-(beta-D-glucosyl)-L-arginine omega-N-glucosyl-L-arginine omega-N-glycosyl-L-arginine Hex Hexose CARBOHYD N-linked (Glc) arginine modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false Q13158:p.Arg117Ala R117A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3258272 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli glycosylation glycosylation reaction glycosylation false false false b7ui21_eco27-ripk1-4 3258263 N/A 3258274 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3258272 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ehecnleb1-fadd-2 3258264 N/A 3258273 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258268 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nleb1-fadd-1 3258265 N/A 3258277 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3258268 unspecified role unspecified role prey prey Region 97-208 Region 97-208 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false b7ui21_eco27-fadd-6 3258266 N/A 3258268 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3258272 enzyme enzyme unspecified role unspecified role B7UI21:p.[Asp221Ala;Asp223Ala] D221A/D223A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli glycosylation glycosylation reaction glycosylation false false false b7ui21_eco27-fadd-7 3258267 N/A 3258268 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3258272 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false