DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ magny-2013-1 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. DIP original experiment: DIP-266813X Science (New York, N.Y.) 2013 IMEx Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. Only protein-protein interactions imex curation magny-2013-2 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. DIP original experiment: DIP-266816X Science (New York, N.Y.) 2013 IMEx Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. Only protein-protein interactions imex curation magny-2013-3 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. DIP original experiment: DIP-266814X Science (New York, N.Y.) 2013 IMEx Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. Only protein-protein interactions imex curation magny-2013-4 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. DIP original experiment: DIP-266815X Science (New York, N.Y.) 2013 IMEx Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. Only protein-protein interactions imex curation atc1_drome Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type SERCA Ca-P60A Calcium ATPase at 60A Calcium pump Sarcoplasmic/endoplasmic reticulum Ca(2+)-ATPase CG3725 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMWAVFFGLLYAMML sarco_human Sarcolipin SLN protein protein human Homo sapiens Human MGINTRELFLNFTIVLITVILMWLLVRSYQY slcb_drome Sarcolamban B SclB CG45091 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNEAKSLFTTFLILAFLLFLLYAFYEAAF ppla_human Cardiac phospholamban PLN PLB protein protein human Homo sapiens Human MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL slca_drome Sarcolamban A SclA CG45090 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSEARNLFTTFGILAILLFFLYLIYAVL sln-ca_p60a-1 3257281 N/A 3257285 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3257286 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false sclb-ca_p60a-1 3257282 N/A 3257287 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3257285 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false pln-ca_p60a-1 3257283 N/A 3257288 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3257285 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false scla-ca_p60a-1 3257284 N/A 3257289 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3257285 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false