DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yang-2013-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yang D., Fang Q., Wang M., Ren R., Wang H., He M., Sun Y., Yang N., Xu RM. DIP original experiment: DIP-255642X Nature structural & molecular biology 2013 IMEx Nα-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain. Yang D., Fang Q., Wang M., Ren R., Wang H., He M., Sun Y., Yang N., Xu RM. Only protein-protein interactions imex curation yang-2013-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang D., Fang Q., Wang M., Ren R., Wang H., He M., Sun Y., Yang N., Xu RM. DIP original experiment: DIP-255643X Nature structural & molecular biology 2013 IMEx Nα-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain. Yang D., Fang Q., Wang M., Ren R., Wang H., He M., Sun Y., Yang N., Xu RM. Only protein-protein interactions imex curation h4_yeast Histone H4 N2752 YBR0122 YBR009C YNL030W HHF1 HHF2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 69B7D1F89E62DE41 h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A h2b1_yeast Histone H2B.1 HTB1 H2B1 SPT12 YDR224C YD9934.09C Suppressor of Ty protein 12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAKAEKKPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQA 9F5E9CFB341DB399 h2a2_yeast Histone H2A.2 HTA2 H2A2 YBL003C YBL0103 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKTAKASQEL E808C94A0363CD53 sir3_yeast Regulatory protein SIR3 SIR3 CMT1 MAR2 STE8 L9753.10 YLR442C Silent information regulator 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAKTLKDLDGWQVIITDDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVSGQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRGTSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSEEIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNPEVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQETQEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFATLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKACSSSGRETILSNFNADINLEESIRESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIHIDALELAGMDALYEKIWFAISKENLCGDISLEALNFYITNVPKAKKRKTLILIQNPENLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIREQINIMPSLKAHFTEIKLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIREGQNQKIPDNVIVINHKINNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFSEAINGFKDETISKKIIGMSLLMRTFLYTLAQETEGTNRHTLALETVLIKMVKMLRDNPGYKASKEIKKVICGAWEPAITIEKLKQFSWISVVNDLVGEKLVVVVLEEPSASIMVELKLPLEINYAFSMDEEFKNMDCI CA2503D7645397AC h2a-h2b-1 3256709 N/A 3256711 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3256712 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3256713 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3256714 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3256715 unspecified role unspecified role unspecified role unspecified role Region 1-219 Region 1-219 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false h2a-h2b-2 3256710 N/A 3256711 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3256712 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3256713 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3256714 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3256715 unspecified role unspecified role unspecified role unspecified role Region 1-219 Region 1-219 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false