DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ song-2013-13 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Song J., Gao X., Galán JE. DIP original experiment: DIP-253499X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation song-2013-14 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Song J., Gao X., Galán JE. DIP original experiment: DIP-253496X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation song-2013-15 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Song J., Gao X., Galán JE. DIP original experiment: DIP-253501X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation song-2013-16 ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Song J., Gao X., Galán JE. DIP original experiment: DIP-253503X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation song-2013-17 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Song J., Gao X., Galán JE. DIP original experiment: DIP-253504X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation song-2013-18 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Song J., Gao X., Galán JE. DIP original experiment: DIP-253498X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation song-2013-19 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Song J., Gao X., Galán JE. DIP original experiment: DIP-253500X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation song-2013-20 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Song J., Gao X., Galán JE. DIP original experiment: DIP-253505X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation song-2013-21 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Song J., Gao X., Galán JE. DIP original experiment: DIP-253497X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation song-2013-22 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Song J., Gao X., Galán JE. DIP original experiment: DIP-253502X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation song-2013-23 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Song J., Gao X., Galán JE. DIP original experiment: DIP-253506X Nature 2013 IMEx Structure and function of the Salmonella Typhi chimaeric A(2)B(5) typhoid toxin. Song J., Gao X., Galán JE. Only protein-protein interactions imex curation podxl_human Podocalyxin PODXL PCLP PCLP1 GCTM-2 antigen Gp200 Podocalyxin-like protein 1 protein protein human Homo sapiens Human MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAALYGCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKKVVSLNGELGDSWIVPLDNLTKDDLDEEEDTHL cdtb_salti Cytolethal distending toxin subunit B homolog cdtB Deoxyribonuclease CdtB STY1886 t1111 protein protein salti Salmonella typhi MKKPVFFLLTMIICSYISFACANISDYKVMTWNLQGSSASTESKWNVNVRQLLSGTAGVDILMVQEAGAVPTSAVPTGRHIQPFGVGIPIDEYTWNLGTTSRQDIRYIYHSAIDVGARRVNLAIVSRQRADNVYVLRPTTVASRPVIGIGLGNDVFLTAHALASGGPDAAAIVRVTINFFRQPQMRHLSWFLAGDFNRSPDRLENDLMTEHLERVVAVLAPTEPTQIGGGILDYGVIVDRAPYSQRVEALRNPQLASDHYPVAFLARSC q8z6a4_salti artA CAJ76_21365 CAJ80_20455 CAJ85_21850 CAL67_19315 CB224_22000 CC884_21775 CC907_20730 CC972_22125 D4Z37_22875 D6Q30_20405 DKA88_22920 DNM71_22620 DNV09_22460 DS261_23225 DUQ91_23130 DUV11_22860 DVG36_22590 EBC38_22940 EID90_22315 ELQ62_22910 EU445_23065 EVI00_22270 F9R11_22580 F9Y21_22595 FI137_21155 GDI29_22180 ZZ17_21795 STY1890 t1108 G2227_22530 G2244_22960 G3982_004275 G3V49_004720 G4I71_004184 G4L28_004282 G4P30_004280 G4Y41_004488 G4Y55_004475 G9264_003910 G9C68_004514 GND71_004364 protein protein salti Salmonella typhi MKKLIFLTLSIVSFNNYAVDFVYRVDSTPPDVIFRDGFSLLGYNRNFQQFISGRSCSGGSSDSRYIATTSSVNQTYAIARAYYSRSTFKGNLYRYQIRADNNFYSLLPSITYLETQGGHFNAYEKTMMRLQREYVSTLSILPENIQKAVALVYDSATGLVKDGVSTMNASYLGLSTTSNPGVIPFLPEPQTYTQQRIDAFGPLISSCFSIGSVCHSHRGQRADVYNMSFYDARPVIELILSK q8z6a3_salti CAJ76_21360 CAJ80_20450 CAJ85_21845 CAL67_19310 CB224_21995 CC884_21770 CC907_20725 CC972_22120 D4Z37_22870 D6Q30_20400 DKA88_22915 DNM71_22615 DNV09_22455 DS261_23220 DUQ91_23125 DUV11_22855 DVG36_22585 EBC38_22935 EID90_22310 ELQ62_22905 EU445_23060 EVI00_22265 F9R11_22575 F9Y21_22590 FI137_21150 GDI29_22175 ZZ17_21790 STY1891 t1107 G2227_22525 G2244_22955 G3982_004274 G4I71_004183 G4L28_004281 G4P30_004279 G4Y41_004487 G4Y55_004474 G9264_003909 G9C68_004513 GND71_004363 protein protein salti Salmonella typhi MYMSKYVPVYTLLILIYSFNASAEWTGDNTNAYYSDEVISELHVGQIDTSPYFCIKTVKANGSGTPVVACAVSKQSIWAPSFKELLDQARYFYSTGQSVRIHVQKNIWTYPLFVNTFSANALVGLSSCSATQCFGPK cdtb-podxl-1 3255542 N/A 3255553 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3255554 unspecified role unspecified role bait bait Region 23-269 Region 23-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false cdtb-q8z6a3_salti-1 3255543 N/A 3255555 unspecified role unspecified role unspecified role unspecified role Region 19-242 Region 19-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255554 unspecified role unspecified role unspecified role unspecified role Region 23-269 Region 23-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255556 unspecified role unspecified role unspecified role unspecified role Region 24-137 Region 24-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false cdtb-q8z6a3_salti-2 3255544 N/A 3255555 unspecified role unspecified role unspecified role unspecified role Region 19-242 Region 19-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255554 unspecified role unspecified role unspecified role unspecified role Region 23-269 Region 23-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255556 unspecified role unspecified role unspecified role unspecified role Region 24-137 Region 24-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false cdtb-q8z6a3_salti-3 3255545 N/A 3255555 unspecified role unspecified role prey prey Region 19-242 Region 19-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255554 unspecified role unspecified role bait bait Region 23-269 Region 23-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3255556 unspecified role unspecified role prey prey Region 24-137 Region 24-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false cdtb-q8z6a3_salti-4 3255546 N/A 3255555 unspecified role unspecified role prey prey Region 19-242 Region 19-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255554 unspecified role unspecified role bait bait Region 23-269 Region 23-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3255556 unspecified role unspecified role prey prey Region 24-137 Region 24-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false cdtb-q8z6a3_salti-5 3255547 N/A 3255555 unspecified role unspecified role unspecified role unspecified role Region 19-242 Region 19-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255554 unspecified role unspecified role unspecified role unspecified role Region 23-269 Region 23-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255556 unspecified role unspecified role unspecified role unspecified role Region 24-137 Region 24-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false q8z6a3_salti-q8z6a4_salti-1 3255548 N/A 3255555 unspecified role unspecified role unspecified role unspecified role Region 19-242 Region 19-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255556 unspecified role unspecified role unspecified role unspecified role Region 24-137 Region 24-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q8z6a4_salti-cdtb-1 3255549 N/A 3255555 unspecified role unspecified role bait bait Region 19-242 Region 19-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3255554 unspecified role unspecified role prey prey Region 23-269 Region 23-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255556 unspecified role unspecified role prey prey Region 24-137 Region 24-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false cdtb-q8z6a3_salti-6 3255550 N/A 3255555 unspecified role unspecified role unspecified role unspecified role Region 19-242 Region 19-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255554 unspecified role unspecified role unspecified role unspecified role Region 23-269 Region 23-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255556 unspecified role unspecified role unspecified role unspecified role Region 24-137 Region 24-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false q8z6a3_salti-q8z6a4_salti-2 3255551 N/A 3255555 unspecified role unspecified role unspecified role unspecified role Region 19-242 Region 19-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3255556 unspecified role unspecified role unspecified role unspecified role Region 24-137 Region 24-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q8z6a4_salti-q8z6a3_salti-1 3255552 N/A 3255555 unspecified role unspecified role bait bait Region 19-242 Region 19-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3255556 unspecified role unspecified role prey prey Region 24-137 Region 24-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false