DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ seiradake-2013-1 human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. DIP original experiment: DIP-254739X Nature structural & molecular biology 2013 IMEx Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. Only protein-protein interactions imex curation seiradake-2013-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. DIP original experiment: DIP-254737X Nature structural & molecular biology 2013 IMEx Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. Only protein-protein interactions imex curation seiradake-2013-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. DIP original experiment: DIP-254738X Nature structural & molecular biology 2013 IMEx Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. Only protein-protein interactions imex curation epha4_human Ephrin type-A receptor 4 EPHA4 EPH-like kinase 8 HEK8 SEK TYRO1 Tyrosine-protein kinase TYRO1 Tyrosine-protein kinase receptor SEK protein protein human Homo sapiens Human MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNTALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMHGRMVPV efna5_human Ephrin-A5 EFNA5 EPLG7 LERK7 EPH-related receptor tyrosine kinase ligand 7 AL-1 protein protein human Homo sapiens Human MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL efnb3_human Ephrin-B3 EFNB3 EPLG8 LERK8 EPH-related receptor transmembrane ligand ELK-L3 EPH-related receptor tyrosine kinase ligand 8 protein protein human Homo sapiens Human MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMPAVAGAAGGLALLLLGVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGELGIALRGGGAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV epha4-1 3255293 N/A 3255296 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 20-547 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false efna5-epha4-2 3255294 N/A 3255296 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 20-547 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3255297 unspecified role unspecified role unspecified role unspecified role Region 27-166 Region 27-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false efnb3-epha4-1 3255295 N/A 3255296 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 20-547 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3255298 unspecified role unspecified role unspecified role unspecified role Region 27-169 Region 27-169 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false