DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lyst-2013-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269244X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-2 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269234X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269231X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-4 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269229X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269237X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-6 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269241X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-7 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269243X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-8 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269238X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-9 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269247X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269232X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-11 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269240X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-12 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269242X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-13 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269246X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-14 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269230X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-15 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269235X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-16 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269245X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-17 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269239X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-18 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269233X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation lyst-2013-19 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269236X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions imex curation ncor1_mouse Nuclear receptor corepressor 1 Ncor1 Rxrip13 Retinoid X receptor-interacting protein 13 protein protein mouse Mus musculus Mouse MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD mecp2_human Methyl-CpG-binding protein 2 MECP2 protein protein human Homo sapiens Human MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI tbl1r_human F-box-like/WD repeat-containing protein TBL1XR1 Transducin beta-like 1X-related protein 1 Nuclear receptor corepressor/HDAC3 complex subunit TBLR1 TBL1-related protein 1 TBL1XR1 IRA1 TBLR1 protein protein human Homo sapiens Human MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYVEAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAASQQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK sin3a_human Paired amphipathic helix protein Sin3a SIN3A Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein human Homo sapiens Human MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP ima3_mouse Importin subunit alpha-3 Kpna4 Qip1 Karyopherin subunit alpha-4 Importin alpha Q1 protein protein mouse Mus musculus Mouse MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPQEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDQAETIANLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPESVQGGTFGFNSSTNVPTEGFQF mint Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus tbl1r_mouse F-box-like/WD repeat-containing protein TBL1XR1 Tbl1xr1 Ira1 Tblr1 Transducin beta-like 1X-related protein 1 Nuclear receptor corepressor/HDAC3 complex subunit TBLR1 TBL1-related protein 1 protein protein mouse Mus musculus Mouse MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYVEAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQHAAAAAAAAAATNQQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPSNKAVVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK hdac3_mouse Histone deacetylase 3 Hdac3 protein protein mouse Mus musculus Mouse MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKES ncor2_mouse Nuclear receptor corepressor 2 Ncor2 Smrt Silencing mediator of retinoic acid and thyroid hormone receptor T3 receptor-associating factor Thyroid-, retinoic-acid-receptor-associated corepressor protein protein mouse Mus musculus Mouse MSGSTQPVAQTWRAAEPRYPPHGISYPVQIARSHTDVGLLEYQHHPRDYTSHLSPGSIIQPQRRRPSLLSEFQPGSERSQELHLRPESRTFLPELGKPDIEFTESKRPRLELLPDTLLRPSPLLATGQPSGSEDLTKDRSLAGKLEPVSPPSPPHADPELELAPSRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMWSEQERDTFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKEEEKQDAENEKEELSKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANHEETATPQQSSELASMEMNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKKTPAAASEETAFPPAAEDEEMEASGASANEEELAEEAEASQASGNEVPRVGECSGPAAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPPEEPAVAPAEPSPVPDASGPPSPEPSPSPAAPPATVDKDEQEAPAAPAPQTEDAKEQKSEAEEIDVGKPEEPEASEEPPESVKSDHKEETEEEPEDKAKGTEAIETVSEAPLKVEEAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKGRLLSPRPSLLTPAGDPRASTSPQKPLDLKQLKQRAAAIPPIVTKVHEPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGGSPRGKSRSPVPPAEKEAEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHAADPSAFSYTPPGHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQLGAISQQGMSVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLGTALGSATSGSITKGLPSTRAADGPSYRGSITHGTPADVLYKGTISRIVGEDSPSRLDRAREDTLPKGHVIYEGKKGHVLSYEGGMSVSQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRTVTSASIEGLMGRAIPEQHSPHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPREELRRTPELPLAPRPLKEGSITQGTPLKYDSGAPSTGTKKHDVRSIIGSPGRPFPALHPLDIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVVVPELGKPRQSPLTYEDHGAPFTSHLPRGSPVTTREPTPRLQEGSLLSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHIPLAFDPTSIPRGIPLEAAAAAYYLPRHLAPSPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAASAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHSSSPLSPGGPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIWRPGTEQSSGAGGSSRPASHTHQHSPISPRTQDALQQRPSVLHNTSMKGVVTSVEPGTPTVLRWARSTSTSSPVRPAATFPPATHCPLGGTLEGVYPTLMEPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPASSPSKSSEPRSLAPPSSSHTAIARTPAKNLAPHHASPDPPAPTSASDLHREKTQSKPFSIQELELRSLGYHSGAGYSPDGVEPISPVSSPSLTHDKGLSKPLEELEKSHLEGELRHKQPGPMKLSAEAAHLPHLRPLPESQPSSSPLLQTAPGIKGHQRVVTLAQHISEVITQDYTRHHPQQLSGPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGKRSPEPSKTSVLGSSEDAIEPVSPPEGMTEPGHARSTAYPLLYRDGEQGEPRMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNIGQPGTEIFNMPAITGAGLMTCRSQAVQEHASTNMGLEAIIRKALMGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE tbl1x_mouse F-box-like/WD repeat-containing protein TBL1X Tbl1x Tbl1 Transducin beta-like protein 1X protein protein mouse Mus musculus Mouse MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQANAAAAAAAAAATATSTAATTPAAAAQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDVERGVCIHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGSLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK ima4_mouse Importin subunit alpha-4 Kpna3 Qip2 Importin alpha Q2 Karyopherin subunit alpha-3 protein protein mouse Mus musculus Mouse MAENPGLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFINPSIPITFLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPSLIPEATQGGTYNFDPTANLQTKEFNF mecp2_mouse Methyl-CpG-binding protein 2 Mecp2 protein protein mouse Mus musculus Mouse MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP ncor1-mecp2-1 3254878 N/A 3254897 unspecified role unspecified role bait bait Region 197-598 Region 197-598 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3254898 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false mecp2-ncor1-1 3254879 N/A 3254897 unspecified role unspecified role prey prey Region 197-598 Region 197-598 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3254898 unspecified role unspecified role bait bait Region 295-319 Region 295-319 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false mecp2-hdac3-1 3254880 N/A 3254899 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254900 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254901 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254898 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 143-309 Region 143-309 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false mecp2-hdac3-2 3254881 N/A 3254902 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254903 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254904 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254905 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254906 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254907 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254897 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254898 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse association association false false false mecp2-tbl1x-1 3254882 N/A 3254906 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3254898 unspecified role unspecified role bait bait Region 295-319 Region 295-319 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false mecp2-hdac3-3 3254883 N/A 3254908 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse N/A 3254909 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254903 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254904 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false mecp2-sin3a-1 3254884 N/A 3254909 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254908 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9Z2D6:p.Arg306Cys R306C mutation mutation certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse physical association physical association false false false mecp2-hdac3-4 3254885 N/A 3254908 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3254909 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254903 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254904 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254897 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false mecp2-ncor2-1 3254886 N/A 3254903 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254905 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254898 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse association association false false false mecp2-hdac3-5 3254887 N/A 3254899 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254900 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254898 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 269-486 Region 269-486 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P51608:p.Pro302Arg P302R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P51608:p.Lys304Glu K304E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P51608:p.Lys305Arg K305R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false mecp2-sin3a-2 3254888 N/A 3254908 unspecified role unspecified role bait bait Q9Z2D6:p.Arg306Cys R306C mutation mutation certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3254909 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false mecp2-hdac3-6 3254889 N/A 3254908 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9Z2D6:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3254903 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254904 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false mecp2-hdac3-7 3254890 N/A 3254908 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3254904 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false mecp2-hdac3-8 3254891 N/A 3254909 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254903 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254904 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254905 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254897 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254898 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse association association false false false mecp2-ncor2-2 3254892 N/A 3254905 unspecified role unspecified role prey prey Region 187-586 Region 187-586 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3254898 unspecified role unspecified role bait bait Region 295-319 Region 295-319 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false tbl1x-mecp2-1 3254893 N/A 3254906 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3254898 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false mecp2-hdac3-9 3254894 N/A 3254908 unspecified role unspecified role bait bait Q9Z2D6:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3254903 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254904 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3254897 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false mecp2-sin3a-3 3254895 N/A 3254901 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254898 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 53-292 Region 53-292 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false mecp2-tbl1xr1-1 3254896 N/A 3254903 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3254898 unspecified role unspecified role bait bait Region 295-319 Region 295-319 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false