DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tripathi-2013-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tripathi S., Li H., Poulos TL. DIP original experiment: DIP-264982X Science (New York, N.Y.) 2013 IMEx Structural basis for effector control and redox partner recognition in cytochrome P450. Tripathi S., Li H., Poulos TL. Only protein-protein interactions imex curation tripathi-2013-2 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Tripathi S., Li H., Poulos TL. DIP original experiment: DIP-264983X Science (New York, N.Y.) 2013 IMEx Structural basis for effector control and redox partner recognition in cytochrome P450. Tripathi S., Li H., Poulos TL. Only protein-protein interactions imex curation cpxa_psepu Camphor 5-monooxygenase camC cyp101 Cytochrome P450-cam protein protein psepu Pseudomonas putida Arthrobacter siderocapsulatus MTTETIQSNANLAPLPPHVPEHLVFDFDMYNPSNLSAGVQEAWAVLQESNVPDLVWTRCNGGHWIATRGQLIREAYEDYRHFSSECPFIPREAGEAYDFIPTSMDPPEQRQFRALANQVVGMPVVDKLENRIQELACSLIESLRPQGQCNFTEDYAEPFPIRIFMLLAGLPEEDIPHLKYLTDQMTRPDGSMTFAEAKEALYDYLIPIIEQRRQKPGTDAISIVANGQVNGRPITSDEAKRMCGLLLVGGLDTVVNFLSFSMEFLAKSPEHRQELIERPERIPAACEELLRRFSLVADGRILTSDYEFHGVQLKKGDQILLPQMLSGLDERENACPMHVDFSRQKVSHTTFGHGSHLCLGQHLARREIIVTLKEWLTRIPDFSIAPGAQIQHKSGIVSGVQALPLVWDPATTKAV putx_psepu Putidaredoxin camB protein protein psepu Pseudomonas putida Arthrobacter siderocapsulatus MSKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW camb-camc-2 3254655 N/A 3254657 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3254658 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false camb-camc-3 3254656 N/A 3254657 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3254658 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false