DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hondele-2013-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252768X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-2 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252756X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-3 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight silver stain molecular weight estimation by silver staining weight silver stain Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252760X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252767X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-5 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight silver stain molecular weight estimation by silver staining weight silver stain Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252764X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252761X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252757X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-8 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252765X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-9 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252762X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-10 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252758X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-11 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252766X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-12 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252763X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation hondele-2013-13 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. DIP original experiment: DIP-252759X Nature 2013 IMEx Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele M., Stuwe T., Hassler M., Halbach F., Bowman A., Zhang ET., Nijmeijer B., Kotthoff C., Rybin V., Amlacher S., Hurt E., Ladurner AG. Only protein-protein interactions imex curation h4_xenla Histone H4 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG q92133_xenla Histone H3 h3c8.S H3l h3c8 hist1h3g protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA g0sdn1_chatd FACT complex subunit CTHT_0052370 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MADIKIDSKLFQERISHFISAWKADKRSGDALFGGVSSIVILMGKVDEEPEFYKNNAMHFWLLGYEFPTTLMLFTLDTLYIITTQKKAKYLDQIKGGRFPVEVLVRGKDNAENEKTFIKIADMIKAAGNKVGVLTKDTSKGPFIDEWKKIFAERCKGVEEVDIALALSAGAFSIKDETELRAMRTSSKACVALLTPYFLDEMSSILDQDKKISHASLADKVMNKLEDEKFWKTVELPNRGKLPSDFDPEQLDWILGPIVQSGGKFDLKWQTDSDDEPLHPGIIIAAMGLRYKSYCSQIARTFMVDPNKSQESNYRVLLAVHNLILKEIRDGVVVKDVYNKAYNLIKTKKPELEKHFLKNVGYGIGLESKDSTLILSAKNTRTLKDGMTLCIVTGFSDIPNPDPQGKKDKVYSLVLTDTIRVTTGEPVVFTGEAPSDMDATSFFFKDEEEAQPTPKKEKKDPRVGAVATRNITSTRLRSERNTAPDEDAEKRRREHQKELAAKKQKEGLLKYADATAGQNGVEVKKFKRFESYKRDNQLPPKVRDMGIVIDQKNNTIVLPIMGRPVPFHINTIKNASKSDEGEWSFLRINFLSPGQGVGRKDDQPFEDASAHFVRSLTFRSTDGDRYAEIANQISNLKREAVKREQEKKDLEDVVEQDKLIEIRNRRPAVLDNVYIRPALEGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIDIQFDETGNRKRKYRYGDEDEFEAEQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQNDSDASDASEEEEDEDSAFEISESELEAASESSEEDSDYEDASEEESDAPPSEDDEGESWDELERKARKRDRESGLDDDDRGGKKRRR g0shk5_chatd FACT complex subunit POB3 CTHT_0070340 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAAIESFDHIYLDLSKEPGKCRFAENGLGWKPVGGGETFTLDVSNIGGAQWSRAARGYEVKILQRTSGVIQLDGFQQEDYERLAKIFKNWYSTNLENKEHSLRGWNWGKAEFGKAELTFNVQNRPAFEIPYSEIANTNLAGRNEIAVEFAPGDHGKSSQNGQVKSKKASASRDQLVEIRFYIPGTTTRKEAEGGEAGSDADEEEKNAVTLFYDTLIEKAEIGETAGDTIATFLDVLHLTPRGRFDIDMYDTSFRLRGKTYDYKIQYEAIKKFMVLPKPDDLHFMLCIGLDPPLRQGQTRYPFIVMQFKQDEEVTLDLNLSEEELNGKYKDRLQAHYEQPAHQVVTYIFKGLANKKVTAPAKDFTTHRGHYGIKCSIKASEGFLYCLEKAFMFVPKPATYISYEQTQSVTFSRVGGAVSTLSTFDITVHMKNGQGSSQFSNINREELKALEDFFKLKGLKVKNEIDEDANLLAAALRDDDMASSDEDVVGGKADRGSADEDEESVDEDFQAESESEVAEEYDSQHESSGSGSDEDDDDLDDDVVDDDEDEEEEEEEEEEEEEERPKKKKKTG h2b(1130) Histone H2B peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GSKKAVTKTQKKDGKKRRKT h3(4665) Histone H3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VALREIRRYQKSTELLIRKL h3tail H3 tail peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRKQL dpoa_yeast DNA polymerase alpha catalytic subunit A POL1 CDC17 DNA polymerase alpha:primase complex p180 subunit DNA polymerase I subunit A N2181 YNL102W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSKSEKLEKLRKLQAARNGTSIDDYEGDESDGDRIYDEIDEKEYRARKRQELLHDDFVVDDDGVGYVDRGVEEDWREVDNSSSDEDTGNLASKDSKRKKNIKREKDHQITDMLRTQHSKSTLLAHAKKSQKKSIPIDNFDDILGEFESGEVEKPNILLPSKLRENLNSSPTSEFKSSIKRVNGNDESSHDAGISKKVKIDPDSSTDKYLEIESSPLKLQSRKLRYANDVQDLLDDVENSPVVATKRQNVLQDTLLANPPSAQSLADEEDDEDSDEDIILKRRTMRSVTTTRRVNIDSRSNPSTSPFVTAPGTPIGIKGLTPSKSLQSNTDVATLAVNVKKEDVVDPETDTFQMFWLDYCEVNNTLILFGKVKLKDDNCVSAMVQINGLCRELFFLPREGKTPTDIHEEIIPLLMDKYGLDNIRAKPQKMKYSFELPDIPSESDYLKVLLPYQTPKSSRDTIPSDLSSDTFYHVFGGNSNIFESFVIQNRIMGPCWLDIKGADFNSIRNASHCAVEVSVDKPQNITPTTTKTMPNLRCLSLSIQTLMNPKENKQEIVSITLSAYRNISLDSPIPENIKPDDLCTLVRPPQSTSFPLGLAALAKQKLPGRVRLFNNEKAMLSCFCAMLKVEDPDVIIGHRLQNVYLDVLAHRMHDLNIPTFSSIGRRLRRTWPEKFGRGNSNMNHFFISDICSGRLICDIANEMGQSLTPKCQSWDLSEMYQVTCEKEHKPLDIDYQNPQYQNDVNSMTMALQENITNCMISAEVSYRIQLLTLTKQLTNLAGNAWAQTLGGTRAGRNEYILLHEFSRNGFIVPDKEGNRSRAQKQRQNEENADAPVNSKKAKYQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQEFNICFTTVDRNKEDIDELPSVPPSEVDQGVLPRLLANLVDRRREVKKVMKTETDPHKRVQCDIRQQALKLTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILMNTRQLAESMNLLVVYGDTDSVMIDTGCDNYADAIKIGLGFKRLVNERYRLLEIDIDNVFKKLLLHAKKKYAALTVNLDKNGNGTTVLEVKGLDMKRREFCPLSRDVSIHVLNTILSDKDPEEALQEVYDYLEDIRIKVETNNIRIDKYKINMKLSKDPKAYPGGKNMPAVQVALRMRKAGRVVKAGSVITFVITKQDEIDNAADTPALSVAERAHALNEVMIKSNNLIPDPQYYLEKQIFAPVERLLERIDSFNVVRLSEALGLDSKKYFRREGGNNNGEDINNLQPLETTITDVERFKDTVTLELSCPSCDKRFPFGGIVSSNYYRVSYNGLQCKHCEQLFTPLQLTSQIEHSIRAHISLYYAGWLQCDDSTCGIVTRQVSVFGKRCLNDGCTGVMRYKYSDKQLYNQLLYFDSLFDCEKNKKQELKPIYLPDDLDYPKEQLTESSIKALTEQNRELMETGRSVVQKYLNDCGRRYVDMTSIFDFMLN 50C9032DBE95B5AE h2b(2648) Histone H2B peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) RKTRKESYAIYVYKVLKQVHPD g0sdn1_chatd-h4_xenla-1 3254213 N/A 3254226 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3254227 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3254228 unspecified role unspecified role unspecified role unspecified role Region 651-944 Region 651-944 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false g0shk5_chatd-g0sdn1_chatd-1 3254214 N/A 3254228 unspecified role unspecified role prey prey Region 521-651 Region 521-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3254229 unspecified role unspecified role bait bait Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false g0sdn1_chatd-h2b(1130)-1 3254215 N/A 3254230 unspecified role unspecified role prey prey in vitro In vitro N/A 3254228 unspecified role unspecified role bait bait Region 651-944 Region 651-944 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false G0SDN1:p.[Asp902Ala;Ser903Ala;Asp905Ala] D902A/S903A/D905A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false h4_xenla-hist1h3g-1 3254216 N/A 3254226 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3254227 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false g0sdn1_chatd-h3(4665)-1 3254217 N/A 3254231 unspecified role unspecified role prey prey in vitro In vitro N/A 3254228 unspecified role unspecified role bait bait Region 651-944 Region 651-944 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false h3(120)-g0sdn1_chatd-1 3254218 N/A 3254232 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false in vitro In vitro N/A 3254228 unspecified role unspecified role prey prey Region 651-944 Region 651-944 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false g0sdn1_chatd-g0shk5_chatd-1 3254219 N/A 3254228 unspecified role unspecified role unspecified role unspecified role Region 521-651 Region 521-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3254229 unspecified role unspecified role unspecified role unspecified role Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false g0sdn1_chatd-h4_xenla-2 3254220 N/A 3254226 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3254227 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3254228 unspecified role unspecified role bait bait Region 772-944 Region 772-944 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-447 Region 1-447 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false h3(4665)-g0sdn1_chatd-1 3254221 N/A 3254231 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false in vitro In vitro N/A 3254228 unspecified role unspecified role prey prey Region 651-944 Region 651-944 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false g0sdn1_chatd-g0shk5_chatd-2 3254222 N/A 3254228 unspecified role unspecified role unspecified role unspecified role Region 521-651 Region 521-651 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3254229 unspecified role unspecified role unspecified role unspecified role Region 1-192 Region 1-192 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false g0shk5_chatd-h4_xenla-1 3254223 N/A 3254229 unspecified role unspecified role bait bait Region 206-485 Region 206-485 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3254226 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3254227 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false g0sdn1_chatd-pol1-1 3254224 N/A 3254233 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3254228 unspecified role unspecified role bait bait Region 521-651 Region 521-651 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false g0sdn1_chatd-h2b(2648)-1 3254225 N/A 3254234 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3254228 unspecified role unspecified role unspecified role unspecified role Region 651-944 Region 651-944 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false