DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bohn-2013-1 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Bohn MF., Shandilya SM., Albin JS., Kouno T., Anderson BD., McDougle RM., Carpenter MA., Rathore A., Evans L., Davis AN., Zhang J., Lu Y., Somasundaran M., Matsuo H., Harris RS., Schiffer CA. DIP original experiment: DIP-252337X Structure (London, England : 1993) 2013 IMEx Crystal structure of the DNA cytosine deaminase APOBEC3F: the catalytically active and HIV-1 Vif-binding domain. Bohn MF., Shandilya SM., Albin JS., Kouno T., Anderson BD., McDougle RM., Carpenter MA., Rathore A., Evans L., Davis AN., Zhang J., Lu Y., Somasundaran M., Matsuo H., Harris RS., Schiffer CA. Only protein-protein interactions imex curation bohn-2013-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bohn MF., Shandilya SM., Albin JS., Kouno T., Anderson BD., McDougle RM., Carpenter MA., Rathore A., Evans L., Davis AN., Zhang J., Lu Y., Somasundaran M., Matsuo H., Harris RS., Schiffer CA. DIP original experiment: DIP-252338X Structure (London, England : 1993) 2013 IMEx Crystal structure of the DNA cytosine deaminase APOBEC3F: the catalytically active and HIV-1 Vif-binding domain. Bohn MF., Shandilya SM., Albin JS., Kouno T., Anderson BD., McDougle RM., Carpenter MA., Rathore A., Evans L., Davis AN., Zhang J., Lu Y., Somasundaran M., Matsuo H., Harris RS., Schiffer CA. Only protein-protein interactions imex curation abc3f_human DNA dC->dU-editing enzyme APOBEC-3F APOBEC3F Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F protein protein human Homo sapiens Human MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE apobec3f-1 3254151 N/A 3254153 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 185-373 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8IUX4:p.[Val225Met;Lys226His;His227Asn;His228Asp] V225M/K226H/H227N/H228D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false apobec3f-2 3254152 N/A 3254153 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 185-373 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false