DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tzeng-2013-1 ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Tzeng SR., Kalodimos CG. DIP original experiment: DIP-266886X Nature chemical biology 2013 IMEx Allosteric inhibition through suppression of transient conformational states. Tzeng SR., Kalodimos CG. Only protein-protein interactions imex curation crp_ecoli cAMP-activated global transcriptional regulator CRP Catabolite activator protein crp cap csm b3357 cAMP regulatory protein JW5702 cAMP receptor protein Catabolite gene activator protein protein ecoli Escherichia coli (strain K12) MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR DCBC24FA46C61B3D crp-5 3253934 N/A 3253935 unspecified role unspecified role unspecified role unspecified role Region 2-210 Region 2-210 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false