DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bergink-2013-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266960X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266951X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266970X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266969X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266952X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266953X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266961X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-8 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266972X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266954X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-10 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266962X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-11 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266971X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266964X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266955X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266963X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266965X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-16 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266975X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266956X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266966X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266973X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-20 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266957X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-21 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266974X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-22 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266958X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-23 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266967X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-24 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266959X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation bergink-2013-25 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. DIP original experiment: DIP-266968X Nature cell biology 2013 IMEx Role of Cdc48/p97 as a SUMO-targeted segregase curbing Rad51-Rad52 interaction. Bergink S., Ammon T., Kern M., Schermelleh L., Leonhardt H., Jentsch S. Only protein-protein interactions imex curation rad51_yeast DNA repair protein RAD51 YER095W RAD51 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQVQEQHISESQLQYGNGSLMSTVPADLSQSVVDGNGNGSSEDIEATNGSGDGGGLQEQAEAQGEMEDEAYDEAALGSFVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDFSGRGELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVAQVDGGMAFNPDPKKPIGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDPREEDE 66561B60122A39A2 rad52_yeast DNA repair and recombination protein RAD52 YML032C RAD52 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNEIMDMDEKKPVFGNHSEDIQTKLDKKLGPEYISKRVGFGTSRIAYIEGWRVINLANQIFGYNGWSTEVKSVVIDFLDERQGKFSIGCTAIVRVTLTSGTYREDIGYGTVENERRKPAAFERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLAKIDKVKFDPPDFDENNLFRPTDEISESSRTNTLHENQEQQQYPNKRRQLTKVTNTNPDSTKNLVKIENTVSRGTPMMAAPAEANSKNSSNKDTDLKSLDASKQDQDDLLDDSLMFSDDFQDDDLINMGNTNSNVLTTEKDPVVAKQSPTASSNPEAEQITFVTAKAATSVQNERYIGEESIFDPKYQAQSIRHTVDQTTSKHIPASVLKDKTMTTARDSVYEKFAPKGKQLSMKNNDKELGPHMLEGAGNQVPRETTPIKTNATAFPPAAAPRFAPPSKVVHPNGNGAVPAVPQQRSTRREVGRPKINPLHARKPT 4F5D07480A05B564 smt3_yeast Ubiquitin-like protein SMT3 SMT3 D9719.15 YDR510W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY A2790DE7F315E1A7 cdc48_yeast Cell division control protein 48 CDC48 Cell division cycle protein 48 Transitional endoplasmic reticulum ATPase homolog YDL126C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGEEHKPLLDASGVDPREEDKTATAILRRKKKDNMLLVDDAINDDNSVIAINSNTMDKLELFRGDTVLVKGKKRKDTVLIVLIDDELEDGACRINRVVRNNLRIRLGDLVTIHPCPDIKYATRISVLPIADTIEGITGNLFDVFLKPYFVEAYRPVRKGDHFVVRGGMRQVEFKVVDVEPEEYAVVAQDTIIHWEGEPINREDEENNMNEVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVANETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAEVLDSLGVTMDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAIKDSIEAHRQHEAEKEVKVEGEDVEMTDEGAKAEQEPEVDPVPYITKEHFAEAMKTAKRSVSDAELRRYEAYSQQMKASRGQFSNFNFNDAPLGTTATDNANSNNSAPSGAGAAFGSNAEEDDDLYS 02ADDB9A227614D8 rad54_yeast DNA repair and recombination protein RAD54 G1821 YGL163C RAD54 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGSDNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRLSHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGEMIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLRELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAFNTSSEDPLKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREVKKVVKGVGGSQPLRAIGILKKLCNHPNLLNFEDEFDDEDDLELPDDYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHCKRCNAQGKQLKRAPAMLYGDATTWNHLNHDALEKTNDHLLKNEHHYNDISFAFQYISH 2EC0A9B7E3D66292 ufd1_yeast Ubiquitin fusion degradation protein 1 UFD1 PIP3 Polymerase-interacting protein 3 YGR048W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSGFSSFGGGNGFVNMPQTFEEFFRCYPIAMMNDRIRKDDANFGGKIFLPPSALSKLSMLNIRYPMLFKLTANETGRVTHGGVLEFIAEEGRVYLPQWMMETLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRNFSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYKALKAQQDKEKKNSFGKGQVLDPSVLGQGSMSTRIDYAGIANSSRNKLSKFVGQGQNISGKAPKAEPKQDIKDMKITFDGEPAKLDLPEGQLFFGFPMVLPKEDEESAAGSKSSEQNFQGQGISLRKSNKRKTKSDHDSSKSKAPKSPEVIEID 198E0CD48B863B98 npl4_yeast Nuclear protein localization protein 4 NPL4 YBR170C YBR1231 HRD4 HMG-CoA reductase degradation protein 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLIRFRSKNGTHRVSCQENDLFGTVIEKLVGNLDPNADVDTFTVCEKPGQGIHAVSELADRTVMDLGLKHGDMLILNYSDKPANEKDGVNVEIGSVGIDSKGIRQHRYGPLRIKELAVDEELEKEDGLIPRQKSKLCKHGDRGMCEYCSPLPPWDKEYHEKNKIKHISFHSYLKKLNENANKKENGSSYISPLSEPDFRINKRCHNGHEPWPRGICSKCQPSAITLQQQEFRMVDHVEFQKSEIINEFIQAWRYTGMQRFGYMYGSYSKYDNTPLGIKAVVEAIYEPPQHDEQDGLTMDVEQVKNEMLQIDRQAQEMGLSRIGLIFTDLSDAGAGDGSVFCKRHKDSFFLSSLEVIMAARHQTRHPNVSKYSEQGFFSSKFVTCVISGNLEGEIDISSYQVSTEAEALVTADMISGSTFPSMAYINDTTDERYVPEIFYMKSNEYGITVKENAKPAFPVDYLLVTLTHGFPNTDTETNSKFVSSTGFPWSNRQAMGQSQDYQELKKYLFNVASSGDFNLLHEKISNFHLLLYINSLQILSPDEWKLLIESAVKNEWEESLLKLVSSAGWQTLVMILQESG 6EF35D21338EE07E rad52-rad51-2 3253562 N/A 3253587 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253588 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad51-sumo-1 3253563 N/A 3253589 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253587 unspecified role unspecified role bait bait P25454:p.[Val321Ala;Val322Ala] V321A/V322A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cdc48-sumo-1 3253564 N/A 3253589 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253590 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false cdc48-rad52-1 3253565 N/A 3253589 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253590 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253588 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false rad51-rad51-7 3253566 N/A 3253587 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253587 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad51-erad52-1 3253567 N/A 3253588 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253587 unspecified role unspecified role bait bait P25454:p.[Val321Ala;Val322Ala] V321A/V322A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad54-rad51-6 3253568 N/A 3253591 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253587 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ufd1-sumo-1 3253569 N/A 3253589 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253592 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false rad52-rad51-5 3253570 N/A 3253588 unspecified role unspecified role bait bait P06778:p.[Lys10Arg;Lys11Arg;Lys220Arg] K10R/K11R/K220R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253587 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad51-rad52-8 3253571 N/A 3253587 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3253588 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false ufd1-rad52-1 3253572 N/A 3253589 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253592 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253588 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false rad51-rad52-9 3253573 N/A 3253588 unspecified role unspecified role prey prey p.Tyr376_Phe379del Δ376-379 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253587 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cdc48-rad52-2 3253574 N/A 3253590 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253588 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad51-rad52-10 3253575 N/A 3253588 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253587 unspecified role unspecified role bait bait P25454:p.[Val321Ala;Val322Ala] V321A/V322A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cdc48-sumo-2 3253576 N/A 3253590 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253589 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ufd1-npl4-3 3253577 N/A 3253593 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253592 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false rad52-cdc48-1 3253578 N/A 3253592 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253590 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253588 unspecified role unspecified role bait bait P06778:p.[Lys10Arg;Lys11Arg;Lys220Arg] K10R/K11R/K220R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false ufd1-sumo-2 3253579 N/A 3253592 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253589 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false erad52-sumo-1 3253580 N/A 3253589 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253588 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ufd1-rad52-2 3253581 N/A 3253592 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253588 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad51-erad52-2 3253582 N/A 3253587 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253589 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253588 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false ufd1-rad52-3 3253583 N/A 3253592 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253588 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false ufd1-npl4-4 3253584 N/A 3253593 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253592 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cdc48-rad52-3 3253585 N/A 3253590 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253588 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false ufd1-cdc48-2 3253586 N/A 3253593 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253590 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253592 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false