DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ han-2013-4 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. DIP original experiment: DIP-259921X Nature cell biology 2013 IMEx ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. Only protein-protein interactions imex curation han-2013-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. DIP original experiment: DIP-259922X Nature cell biology 2013 IMEx ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. Only protein-protein interactions imex curation han-2013-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. DIP original experiment: DIP-259923X Nature cell biology 2013 IMEx ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. Only protein-protein interactions imex curation ddit3_mouse DNA damage-inducible transcript 3 protein Ddit3 Chop Chop10 Gadd153 C/EBP zeta C/EBP-homologous protein C/EBP-homologous protein 10 CCAAT/enhancer-binding protein homologous protein Growth arrest and DNA-damage-inducible protein GADD153 protein protein mouse Mus musculus Mouse MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA atf4_mouse Cyclic AMP-dependent transcription factor ATF-4 Atf4 C/EBP-related ATF Activating transcription factor 4 Creb2 Cyclic AMP-responsive element-binding protein 2 protein protein mouse Mus musculus Mouse MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP atf4-ddit3-2 3253546 N/A 3253549 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3253550 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false atf4-ddit3-3 3253547 N/A 3253549 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3253550 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false ddit3-atf4-4 3253548 N/A 3253549 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3253550 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false