DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ querol_audi-2013-1 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252291X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-2 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252304X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-3 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252284X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252290X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-5 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252301X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-6 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252307X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-7 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252288X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252300X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-9 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252293X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-10 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252285X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-11 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252303X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-12 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252298X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-13 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252306X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-14 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252292X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-15 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252299X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-16 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252295X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-17 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252309X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-18 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252286X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-19 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252289X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-20 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252294X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-21 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252308X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-22 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252297X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-23 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252287X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-24 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252296X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-25 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252302X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation querol_audi-2013-26 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252305X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions imex curation eif1_human Eukaryotic translation initiation factor 1 Protein translation factor SUI1 homolog Sui1iso1 A121 EIF1 SUI1 protein protein human Homo sapiens Human MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF eif3c_human Eukaryotic translation initiation factor 3 subunit C EIF3C EIF3S8 Eukaryotic translation initiation factor 3 subunit 8 eIF3 p110 protein protein human Homo sapiens Human MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMRRGGYRQQQSQTAY eif3a_human Eukaryotic translation initiation factor 3 subunit A EIF3A KIAA0139 EIF3S10 Eukaryotic translation initiation factor 3 subunit 10 eIF-3-theta eIF3 p167 eIF3 p180 eIF3 p185 protein protein human Homo sapiens Human MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEKEPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWRKGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADDDRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWGPPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDRVEERDPPRRVPPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTVRR eif3m_human Eukaryotic translation initiation factor 3 subunit M EIF3M HFLB5 PCID1 PCI domain-containing protein 1 Fetal lung protein B5 GA17 PNAS-125 protein protein human Homo sapiens Human MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT eif3l_human Eukaryotic translation initiation factor 3 subunit L EIF3L HSPC021 HSPC025 EIF3S6IP Eukaryotic translation initiation factor 3 subunit 6-interacting protein MSTP005 EIF3EIP Eukaryotic translation initiation factor 3 subunit E-interacting protein protein protein human Homo sapiens Human MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIIDEFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMGQRP eif3k_human Eukaryotic translation initiation factor 3 subunit K MSTP001 PTD001 HSPC029 EIF3K ARG134 EIF3S12 Eukaryotic translation initiation factor 3 subunit 12 eIF-3 p25 eIF-3 p28 Muscle-specific gene M9 protein PLAC-24 protein protein human Homo sapiens Human MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ eif3h_human Eukaryotic translation initiation factor 3 subunit H EIF3S3 Eukaryotic translation initiation factor 3 subunit 3 eIF-3-gamma eIF3 p40 subunit EIF3H protein protein human Homo sapiens Human MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN eif3f_human Eukaryotic translation initiation factor 3 subunit F Eukaryotic translation initiation factor 3 subunit 5 eIF-3-epsilon eIF3 p47 EIF3F EIF3S5 Deubiquitinating enzyme eIF3f protein protein human Homo sapiens Human MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL eif3e_human Eukaryotic translation initiation factor 3 subunit E EIF3E INT6 EIF3S6 Eukaryotic translation initiation factor 3 subunit 6 eIF-3 p48 Viral integration site protein INT-6 homolog protein protein human Homo sapiens Human MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY eif3j_human Eukaryotic translation initiation factor 3 subunit J EIF3J PRO0391 EIF3S1 Eukaryotic translation initiation factor 3 subunit 1 eIF-3-alpha eIF3 p35 protein protein human Homo sapiens Human MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM eif3d_human Eukaryotic translation initiation factor 3 subunit D EIF3D EIF3S7 Eukaryotic translation initiation factor 3 subunit 7 eIF-3-zeta eIF3 p66 protein protein human Homo sapiens Human MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQILPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEEEEET if1ax_human Eukaryotic translation initiation factor 1A, X-chromosomal Eukaryotic translation initiation factor 4C EIF1AX EIF1A EIF4C protein protein human Homo sapiens Human MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI eif1-eif3a-1 3253223 N/A 3253249 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif3e-eif3a-1 3253224 N/A 3253252 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253253 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253254 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253255 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253256 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253257 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif3a-eif3c-1 3253225 N/A 3253252 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253254 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253255 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253256 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false eif3a-eif3c-2 3253226 N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false eif3a-eif3c-3 3253227 N/A 3253252 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253254 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253255 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253256 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif3m-eif3a-1 3253228 N/A 3253252 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253253 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253254 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253255 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253256 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif3a-eif3c-4 3253229 N/A 3253258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253252 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253254 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253255 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253256 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false eif3a-eif3c-5 3253230 N/A 3253258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253252 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253254 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253255 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253256 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false eif1-eif3c-1 3253231 N/A 3253249 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false eif3a-eif3c-6 3253232 N/A 3253252 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253254 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253255 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253256 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false eif3a-eif3c-7 3253233 N/A 3253252 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253253 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253254 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253255 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253256 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif3a-eif3c-8 3253234 N/A 3253259 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253252 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253254 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253255 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253256 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false eif3l-eif3a-1 3253235 N/A 3253252 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253253 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253254 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253255 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253256 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif1-eif3a-2 3253236 N/A 3253249 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false eif3j-eif3a-1 3253237 N/A 3253258 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253252 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253253 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253254 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253255 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253256 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif1ax-eif3a-1 3253238 N/A 3253260 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false eif3h-eif3a-1 3253239 N/A 3253252 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253253 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253254 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253255 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253256 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif3a-eif3c-9 3253240 N/A 3253259 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253252 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253254 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253255 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253256 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false eif3a-eif3c-10 3253241 N/A 3253258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253252 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253254 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253255 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253256 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false eif1ax-eif3a-2 3253242 N/A 3253260 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif3f-eif3a-1 3253243 N/A 3253252 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253253 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253254 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253255 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253256 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif3d-eif3a-1 3253244 N/A 3253259 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253252 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253253 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253254 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253255 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253256 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eif3a-eif3c-11 3253245 N/A 3253259 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253252 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253254 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253255 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253256 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false eif1ax-eif3c-1 3253246 N/A 3253260 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false eif3a-eif3c-12 3253247 N/A 3253252 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253254 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253255 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253256 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253257 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253250 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false eif3k-eif3a-1 3253248 N/A 3253252 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253253 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253254 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3253255 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253256 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253257 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3253250 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3253251 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false