DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hatherley-2013-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hatherley D., Lea SM., Johnson S., Barclay AN. DIP original experiment: DIP-252276X Structure (London, England : 1993) 2013 IMEx Structures of CD200/CD200 receptor family and implications for topology, regulation, and evolution. Hatherley D., Lea SM., Johnson S., Barclay AN. Only protein-protein interactions imex curation hatherley-2013-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hatherley D., Lea SM., Johnson S., Barclay AN. DIP original experiment: DIP-252274X Structure (London, England : 1993) 2013 IMEx Structures of CD200/CD200 receptor family and implications for topology, regulation, and evolution. Hatherley D., Lea SM., Johnson S., Barclay AN. Only protein-protein interactions imex curation hatherley-2013-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hatherley D., Lea SM., Johnson S., Barclay AN. DIP original experiment: DIP-252275X Structure (London, England : 1993) 2013 IMEx Structures of CD200/CD200 receptor family and implications for topology, regulation, and evolution. Hatherley D., Lea SM., Johnson S., Barclay AN. Only protein-protein interactions imex curation hatherley-2013-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hatherley D., Lea SM., Johnson S., Barclay AN. DIP original experiment: DIP-252277X Structure (London, England : 1993) 2013 IMEx Structures of CD200/CD200 receptor family and implications for topology, regulation, and evolution. Hatherley D., Lea SM., Johnson S., Barclay AN. Only protein-protein interactions imex curation ox2g_mouse OX-2 membrane glycoprotein Cd200 Mox2 MRC OX-2 antigen protein protein mouse Mus musculus Mouse MGSLVFRRPFCHLSTYSLIWGMAAVALSTAQVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK mint Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues mo2r4_mouse Cell surface glycoprotein CD200 receptor 4 Cd200r4 CD200 cell surface glycoprotein receptor-like 4 CD200 cell surface glycoprotein receptor-like a Cell surface glycoprotein OX2 receptor 4 protein protein mouse Mus musculus Mouse MHALGRIPTLTLLIFINIFVSGSSCTDENQTIQNDSSSSLTQVNTTMSVQMDKKALLCCFSSPLINAVLITWIIKHRHLPSCTIAYNLDKKTNETSCLGRNITWASTPDHSPELQISAVALQHEGTYTCEIVTPEGNLEKVYDLQVLVPPEVTYFPGKNRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSVVSCLVSHSTGNQSLSIELSQGTMTTPRSLLTILYVKMALLVIILLNVGFAFFQKRNFART mo2r1_mouse Cell surface glycoprotein CD200 receptor 1 Cd200r1 Mox2r Ox2r CD200 cell surface glycoprotein receptor Cell surface glycoprotein OX2 receptor 1 protein protein mouse Mus musculus Mouse MFCFWRTSALAVLLIWGVFVAGSSCTDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRPYIPYIIPSIIILIIIGCICLLKISGFRKCKLPKLEATSAIEEDEMQPYASYTEKSNPLYDTVTKVEAFPVSQGEVNGTDCLTLSAIGI cd200r4-cd200-1 3253008 N/A 3253012 unspecified role unspecified role prey prey Extracellular domain Region 31-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3253013 unspecified role unspecified role bait bait Extracellular domain Region 26-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q6XJV4:p.[Asn87Lys;Lys90Thr;Leu138Phe] N87K/K90T/L138F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q6XJV4:p.Leu138Phe L138F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q6XJV4:p.[Asn87Lys;Lys90Thr] N87K/K90T mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false cd200-cd200r1-1 3253009 N/A 3253012 unspecified role unspecified role unspecified role unspecified role Extracellular domain Region 31-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3253014 unspecified role unspecified role unspecified role unspecified role Extracellular domain Region 26-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction false false false cd200r1-cd200-1 3253010 N/A 3253012 unspecified role unspecified role prey prey Extracellular domain Region 31-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3253014 unspecified role unspecified role bait bait Extracellular domain Region 26-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false cd200-cd200r1-2 3253011 N/A 3253012 unspecified role unspecified role bait bait Extracellular domain Region 31-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O54901:p.Asn74Asp N74D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O54901:p.Asn74Ala N74A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O54901:p.Leu60Lys L60K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O54901:p.Ile61Glu I61E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O54901:p.Leu122Ala L122A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O54901:p.Asn124Lys N124K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O54901:p.Phe126Asp F126D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O54901:p.Phe126Ala F126A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O54901:p.Lys130Glu K130E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3253014 unspecified role unspecified role prey prey Extracellular domain Region 26-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction false false false