DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhang-2013-13 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252252X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions imex curation zhang-2013-14 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252250X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions imex curation zhang-2013-15 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252255X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions imex curation zhang-2013-16 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252257X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions imex curation zhang-2013-17 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252256X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions imex curation zhang-2013-18 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252259X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions imex curation zhang-2013-19 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252254X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions imex curation zhang-2013-20 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252258X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions imex curation zhang-2013-21 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252251X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions imex curation zhang-2013-22 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252253X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions imex curation q9p289-1 Serine/threonine-protein kinase 26 STK26 MASK MST4 MST3 and SOK1-related kinase Mammalian STE20-like protein kinase 4 Serine/threonine-protein kinase MASK protein protein human Homo sapiens Human MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP pdc10_human Programmed cell death protein 10 PDCD10 CCM3 TFAR15 TF-1 cell apoptosis-related protein 15 Cerebral cavernous malformations 3 protein protein protein human Homo sapiens Human MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA stk24_human Serine/threonine-protein kinase 24 STK24 MST3 STK3 STE20-like kinase MST3 Mammalian STE20-like protein kinase 3 protein protein human Homo sapiens Human MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH pdcd10-stk26-3 3252524 N/A 3252534 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3252535 unspecified role unspecified role bait bait Q9BUL8:p.Met26Glu M26E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9BUL8:p.Leu44Asp L44D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9BUL8:p.Phe48Glu F48E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9BUL8:p.Ile66Asp I66D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9BUL8:p.[Met26Glu;Leu44Asp;Phe48Glu;Ile66Asp] M26E/L44D/F48E/I66D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pdcd10-stk26-4 3252525 N/A 3252534 unspecified role unspecified role unspecified role unspecified role Region 325-413 Region 325-413 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252535 unspecified role unspecified role unspecified role unspecified role Region 9-212 Region 9-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false stk26-pdcd10-5 3252526 N/A 3252534 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9P289-1:p.[Phe361Glu;Leu381Asp;Met399Glu;Leu403Asp] F361E/L381D/M399E/L403D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Phe361Glu F361E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Leu381Asp L381D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Met399Glu M399E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Leu403Asp L403D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Phe407Glu F407E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3252535 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false pdcd10-stk24-8 3252527 N/A 3252536 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3252535 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false pdcd10-stk26-5 3252528 N/A 3252534 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3252535 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false stk24-pdcd10-2 3252529 N/A 3252536 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3252535 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false stk26-pdcd10-6 3252530 N/A 3252534 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3252535 unspecified role unspecified role prey prey Q9BUL8:p.Met26Glu M26E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9BUL8:p.Leu44Asp L44D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9BUL8:p.Phe48Glu F48E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9BUL8:p.Ile66Asp I66D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9BUL8:p.[Met26Glu;Leu44Asp;Phe48Glu;Ile66Asp] M26E/L44D/F48E/I66D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false stk26-pdcd10-7 3252531 N/A 3252534 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3252535 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false pdcd10-stk26-6 3252532 N/A 3252534 unspecified role unspecified role unspecified role unspecified role Region 325-413 Region 325-413 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252535 unspecified role unspecified role unspecified role unspecified role Region 9-212 Region 9-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pdcd10-stk26-7 3252533 N/A 3252534 unspecified role unspecified role prey prey Q9P289-1:p.Met399Glu M399E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Leu381Asp L381D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.[Phe361Glu;Leu381Asp;Met399Glu;Leu403Asp] F361E/L381D/M399E/L403D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252535 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false