DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ quigley-2013-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Quigley A., Dong YY., Pike AC., Dong L., Shrestha L., Berridge G., Stansfeld PJ., Sansom MS., Edwards AM., Bountra C., von Delft F., Bullock AN., Burgess-Brown NA., Carpenter EP. DIP original experiment: DIP-266834X Science (New York, N.Y.) 2013 IMEx The structural basis of ZMPSTE24-dependent laminopathies. Quigley A., Dong YY., Pike AC., Dong L., Shrestha L., Berridge G., Stansfeld PJ., Sansom MS., Edwards AM., Bountra C., von Delft F., Bullock AN., Burgess-Brown NA., Carpenter EP. Only protein-protein interactions imex curation quigley-2013-2 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Quigley A., Dong YY., Pike AC., Dong L., Shrestha L., Berridge G., Stansfeld PJ., Sansom MS., Edwards AM., Bountra C., von Delft F., Bullock AN., Burgess-Brown NA., Carpenter EP. DIP original experiment: DIP-266835X Science (New York, N.Y.) 2013 IMEx The structural basis of ZMPSTE24-dependent laminopathies. Quigley A., Dong YY., Pike AC., Dong L., Shrestha L., Berridge G., Stansfeld PJ., Sansom MS., Edwards AM., Bountra C., von Delft F., Bullock AN., Burgess-Brown NA., Carpenter EP. Only protein-protein interactions imex curation p02545-1 Prelamin-A/C Lamin A LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNCSIM face1_human CAAX prenyl protease 1 homolog ZMPSTE24 FACE1 STE24 Prenyl protein-specific endoprotease 1 Farnesylated proteins-converting enzyme 1 Zinc metalloproteinase Ste24 homolog protein protein human Homo sapiens Human MGMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH lmna-zmpste24-1 3252462 N/A 3252464 unspecified role unspecified role unspecified role unspecified role Region 661-664 Region 661-664 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3252465 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false lmna-zmpste24-2 3252463 N/A 3252464 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 643-656 Region 643-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 656-664 Region 656-664 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3252465 enzyme enzyme unspecified role unspecified role O75844:p.Glu336Ala E336A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm protein cleavage protein cleavage false false false