DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ miallau-2013-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Miallau L., Jain P., Arbing MA., Cascio D., Phan T., Ahn CJ., Chan S., Chernishof I., Maxson M., Chiang J., Jacobs WR., Eisenberg DS. DIP original experiment: DIP-252219X Structure (London, England : 1993) 2013 IMEx Comparative proteomics identifies the cell-associated lethality of M. tuberculosis RelBE-like toxin-antitoxin complexes. Miallau L., Jain P., Arbing MA., Cascio D., Phan T., Ahn CJ., Chan S., Chernishof I., Maxson M., Chiang J., Jacobs WR., Eisenberg DS. Only protein-protein interactions imex curation miallau-2013-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Miallau L., Jain P., Arbing MA., Cascio D., Phan T., Ahn CJ., Chan S., Chernishof I., Maxson M., Chiang J., Jacobs WR., Eisenberg DS. DIP original experiment: DIP-252220X Structure (London, England : 1993) 2013 IMEx Comparative proteomics identifies the cell-associated lethality of M. tuberculosis RelBE-like toxin-antitoxin complexes. Miallau L., Jain P., Arbing MA., Cascio D., Phan T., Ahn CJ., Chan S., Chernishof I., Maxson M., Chiang J., Jacobs WR., Eisenberg DS. Only protein-protein interactions imex curation relg_myctu Toxin RelG relG Putative endoribonuclease RelG relE2 Rv2866 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR 26A297E3CA6C64F5 relf_myctu Antitoxin RelF relF relB2 Rv2865 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MRILPISTIKGKLNEFVDAVSSTQDQITITKNGAPAAVLVGADEWESLQETLYWLAQPGIRESIAEADADIASGRTYGEDEIRAEFGVPRRPH 07F97E029D3B537A relk_myctu Toxin RelK relK relE3 yoeB Endoribonuclease YoeB Putative mRNA interferase RelE3 Putative mRNA interferase YoeB Toxin YoeB MTV004.15 Rv3358 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLKARYHY 8663A289B5FD9DAF relj_myctu Antitoxin RelJ relJ relB3 yefM Antitoxin YefM MTV004.14 Rv3357 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENARRLMEAVARDKAGHSAFTKSVDELREMAGGEE 5A4140972F329F0A relb2-rele2-1 3252129 N/A 3252131 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3252132 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false relb3-rele3-1 3252130 N/A 3252133 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3252134 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false