DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ xing-2013-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252786X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-2 trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252772X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252783X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-4 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252780X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-5 trini Trichoplusia ni (Cabbage looper) Cabbage looper ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252776X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252785X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-7 trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252773X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-8 trini Trichoplusia ni (Cabbage looper) Cabbage looper ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252777X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252784X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-10 trini Trichoplusia ni (Cabbage looper) Cabbage looper ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252774X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-11 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252778X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-12 trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252782X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-13 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252775X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-14 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252787X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation xing-2013-15 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252779X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions imex curation p63208-1 S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 Organ of Corti protein 2 Organ of Corti protein II RNA polymerase II elongation factor-like protein SIII p19skp1 Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK fbxl3_human F-box/LRR-repeat protein 3 FBL3A FBXL3A F-box and leucine-rich repeat protein 3A F-box/LRR-repeat protein 3A FBXL3 protein protein human Homo sapiens Human MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEFDPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKNLSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVWFPDMMPTW cry2_mouse Cryptochrome-2 Cry2 Kiaa0658 protein protein mouse Mus musculus Mouse MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQAGSISNTGPRALSSGPASPKRKLEAAEEPPGEELTKRARVTEMPTQEPASKDS bmal1_human Aryl hydrocarbon receptor nuclear translocator-like protein 1 ARNTL BMAL1 MOP3 Brain and muscle ARNT-like 1 Member of PAS protein 3 Basic-helix-loop-helix-PAS protein MOP3 bHLH-PAS protein JAP3 BHLHE5 PASD3 PAS domain-containing protein 3 Class E basic helix-loop-helix protein 5 protein protein human Homo sapiens Human MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL per1_human Period circadian protein homolog 1 KIAA0482 PER RIGUI Circadian clock protein PERIOD 1 Circadian pacemaker protein Rigui PER1 protein protein human Homo sapiens Human MSGPLEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCSMDMSTYTLEELEHITSEYTLQNQDTFSVAVSFLTGRIVYISEQAAVLLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRLPTWGTGASAGSGLRDFTQEKSVFCRIRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAPSLDTDIQELSEQIHRLLLQPVHSPSPTGLCGVGAVTSPGPLHSPGSSSDSNGGDAEGPGPPAPVTFQQICKDVHLVKHQGQQLFIESRARPQSRPRLPATGTFKAKALPCQSPDPELEAGSAPVQAPLALVPEEAERKEASSCSYQQINCLDSILRYLESCNLPSTTKRKCASSSSYTTSSASDDDRQRTGPVSVGTKKDPPSAALSGEGATPRKEPVVGGTLSPLALANKAESVVSVTSQCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAPDAYRPVGLTKAVLSLHTQKEEQAFLSRFRDLGRLRGLDSSSTAPSALGERGCHHGPAPPSRRHHCRSKAKRSRHHQNPRAEAPCYVSHPSPVPPSTPWPTPPATTPFPAVVQPYPLPVFSPRGGPQPLPPAPTSVPPAAFPAPLVTPMVALVLPNYLFPTPSSYPYGALQTPAEGPPTPASHSPSPSLPALAPSPPHRPDSPLFNSRCSSPLQLNLLQLEELPRAEGAAVAGGPGSSAGPPPPSAEAAEPEARLAEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRSSQSSHTSKYFGSIDSSEAEAGAARGGAEPGDQVIKYVLQDPIWLLMANADQRVMMTYQVPSRDMTSVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVMACVDCGSSTQDPGHPDDPLFSELDGLGLEPMEEGGGEQGSSGGGSGEGEGCEEAQGGAKASSSQDLAMEEEEEGRSSSSPALPTAGNCTS per2_mouse Period circadian protein homolog 2 Per2 Circadian clock protein PERIOD 2 protein protein mouse Mus musculus Mouse MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDNGKELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYSMEQVEGITSEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSYTTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAPPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGQEESHRRRSGIFKTSGKIQTKSHVSHESGGQKEASVAEMQSSPPAQVKAVTTIERDSSGASLPKASFPEELAYKNQPPCSYQQISCLDSVIRYLESCSEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESVVSLTSQCSYSSTIVHVGDKKPQPELETVEDMASGPESLDGAAGGLSQEKGPLQKLGLTKEVLAAHTQKEEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGLESSWKKTGKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLMGLNATAWSPSDTSQSSCPSAPFPTAVPAYPLPVFQAPGIVSTPGTVVAPPAATHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAFMLPSYPFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSTLRQPCACPVTPPAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGTSRDRQPKAPPTCNEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLGSSSLGFGTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMIPDTEESEQFIKYVLQDPIWLLMANTDDSIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGGLPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTGPRIEAQT skp1_mouse S-phase kinase-associated protein 1 Skp1 Skp1a S-phase kinase-associated protein 1A Cyclin-A/CDK2-associated protein p19 p19skp1 p19A protein protein mouse Mus musculus Mouse MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK cry2-fbxl3-1 3251933 N/A 3251948 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251949 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251950 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R194:p.Phe428Asp F428D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9R194:p.Ile499Asp I499D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false cry2-fbxl3-2 3251934 N/A 3251948 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251949 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251950 unspecified role unspecified role unspecified role unspecified role Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false cry2-arntl-1 3251935 N/A 3251951 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251952 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251948 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251949 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251950 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R194:p.Arg376Ala R376A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false fbxl3-cry2-5 3251936 N/A 3251950 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3251949 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9UKT7:p.Glu336Ala E336A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9UKT7:p.Tyr314Ala Y314A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Region 424-428 Region 424-428 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9UKT7:p.Pro426Ala P426A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9UKT7:p.Trp428Ala W428A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9UKT7:p.Tyr292Ala Y292A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse physical association physical association false false false Fig. 6A cry2-fbxl3-3 3251937 N/A 3251948 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251949 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251950 unspecified role unspecified role unspecified role unspecified role Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false cry2-per1-1 3251938 N/A 3251952 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251950 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R194:p.Asp339Arg D339R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false fbxl3-cry2-6 3251939 N/A 3251948 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251949 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251950 unspecified role unspecified role prey prey Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false cry2-fbxl3-4 3251940 N/A 3251949 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251950 unspecified role unspecified role unspecified role unspecified role Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false cry2-arntl-2 3251941 N/A 3251951 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251948 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251949 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251950 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R194:p.Asp339Arg D339R mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false cry2-fbxl3-5 3251942 N/A 3251948 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251949 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251950 unspecified role unspecified role unspecified role unspecified role Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false per2-cry2-2 3251943 N/A 3251950 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3251953 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false fbxl3-cry2-7 3251944 N/A 3251949 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251950 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false cry2-fbxl3-6 3251945 N/A 3251948 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251949 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3251950 unspecified role unspecified role unspecified role unspecified role Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false cry2-arntl-3 3251946 N/A 3251951 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251952 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3251950 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9R194:p.Phe428Asp F428D mutation mutation certain certain sequence position certain certain certain sequence position certain false Q9R194:p.Ile499Asp I499D mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false fbxl3-cry2-8 3251947 N/A 3251954 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3251950 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3251949 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse association association false false false