DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ broussard-2013-1 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. DIP original experiment: DIP-252207X Structure (London, England : 1993) 2013 IMEx The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. Only protein-protein interactions imex curation broussard-2013-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. DIP original experiment: DIP-252208X Structure (London, England : 1993) 2013 IMEx The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. Only protein-protein interactions imex curation broussard-2013-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. DIP original experiment: DIP-252209X Structure (London, England : 1993) 2013 IMEx The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. Only protein-protein interactions imex curation accc_ecoli Biotin carboxylase accC fabG b3256 Acetyl-CoA carboxylase subunit A JW3224 protein protein ecoli Escherichia coli (strain K12) MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQSISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGQPLSIKQEEVHVRGHAVECRINAEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDLQIRIMNDENFQHGGTNIHYLEKKLGLQEK bccp_ecoli Biotin carboxyl carrier protein of acetyl-CoA carboxylase accB fabE b3255 JW3223 protein protein ecoli Escherichia coli (strain K12) MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSNAAAPATVPSMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE accb-accc-1 3251874 N/A 3251877 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3251878 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false accb-accc-2 3251875 N/A 3251877 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3251878 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false accb-accc-3 3251876 N/A 3251877 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3251878 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false