DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ canzio-2013-1 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. DIP original experiment: DIP-252801X Nature 2013 IMEx A conformational switch in HP1 releases auto-inhibition to drive heterochromatin assembly. Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. Only protein-protein interactions imex curation canzio-2013-2 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. DIP original experiment: DIP-252799X Nature 2013 IMEx A conformational switch in HP1 releases auto-inhibition to drive heterochromatin assembly. Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. Only protein-protein interactions imex curation canzio-2013-3 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. DIP original experiment: DIP-252802X Nature 2013 IMEx A conformational switch in HP1 releases auto-inhibition to drive heterochromatin assembly. Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. Only protein-protein interactions imex curation canzio-2013-4 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. DIP original experiment: DIP-252800X Nature 2013 IMEx A conformational switch in HP1 releases auto-inhibition to drive heterochromatin assembly. Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. Only protein-protein interactions imex curation canzio-2013-5 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. DIP original experiment: DIP-252804X Nature 2013 IMEx A conformational switch in HP1 releases auto-inhibition to drive heterochromatin assembly. Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. Only protein-protein interactions imex curation canzio-2013-6 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. DIP original experiment: DIP-252803X Nature 2013 IMEx A conformational switch in HP1 releases auto-inhibition to drive heterochromatin assembly. Canzio D., Liao M., Naber N., Pate E., Larson A., Wu S., Marina DB., Garcia JF., Madhani HD., Cooke R., Schuck P., Cheng Y., Narlikar GJ. Only protein-protein interactions imex curation h3k4me3-2 H3K4me3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRK swi6_schpo Chromatin-associated protein swi6 swi6 SPAC664.01c SPAC824.10c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEVESDHESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKKCPQKMLQFYESHLTFRENE F505CC8AC5E75EAB h3k9-swi6-1 3251789 N/A 3251795 unspecified role unspecified role unspecified role unspecified role K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3251796 unspecified role unspecified role unspecified role unspecified role MSL-label MSL-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false swi6-3 3251790 N/A 3251796 unspecified role unspecified role unspecified role unspecified role P40381:p.[Arg93Ala;Lys94Ala] R93A/K94A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P40381:p.Trp104Ala W104A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P40381:p.Glu74_Glu80delinsAlaAlaAlaAlaAlaAlaAla E74A/E75A/E76A/E77A/E78E/D79A/E80A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P40381:p.Leu315Asp L315D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P40381:p.[Cys121Ser;Cys124Ser;Cys310Ser] C121S/C124S/C310S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false swi6-4 3251791 N/A 3251796 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false h3k9-swi6-2 3251792 N/A 3251795 unspecified role unspecified role unspecified role unspecified role K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3251796 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false h3k9-swi6-3 3251793 N/A 3251795 unspecified role unspecified role unspecified role unspecified role K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3251796 unspecified role unspecified role unspecified role unspecified role MSL-label MSL-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h3k9-swi6-4 3251794 N/A 3251795 unspecified role unspecified role unspecified role unspecified role K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3251796 unspecified role unspecified role unspecified role unspecified role P40381:p.Glu74_Glu80delinsAlaAlaAlaAlaAlaAlaAla E74A/E75A/E76A/E77A/E78E/D79A/E80A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P40381:p.Trp104Ala W104A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P40381:p.[Arg93Ala;Lys94Ala] R93A/K94A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P40381:p.[Cys121Ser;Cys124Ser;Cys310Ser] C121S/C124S/C310S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false